BLASTX nr result
ID: Ephedra26_contig00006731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00006731 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447768.1| hypothetical protein SORBIDRAFT_06g015290 [S... 50 2e-06 gb|EMT13069.1| hypothetical protein F775_11147 [Aegilops tauschii] 47 6e-06 gb|EXC17848.1| hypothetical protein L484_023204 [Morus notabilis] 49 8e-06 >ref|XP_002447768.1| hypothetical protein SORBIDRAFT_06g015290 [Sorghum bicolor] gi|241938951|gb|EES12096.1| hypothetical protein SORBIDRAFT_06g015290 [Sorghum bicolor] Length = 220 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +3 Query: 6 KVLVSVTVGQSSGPLRVLICEDATVQDVMKEVISLYSKEGRRPSLPS 146 KVLVSV V QS PL V+ + TV D++ ++LY KEGRRP LPS Sbjct: 97 KVLVSVAVQQSMWPLHVMASAEWTVADLVAAAVALYVKEGRRPLLPS 143 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +1 Query: 157 DCLDAQAMIKDLGSRDFFMRLKEQTVKDDCIATACTNGSSVNRIPGSGAGICWYSKL 327 + LD + I +LGSR FF+ + D +++ + V R SG W S + Sbjct: 159 ESLDPKEKIMELGSRSFFLCPRSSAAGQDASSSSPGTANGVIR-AASGKTPAWLSNM 214 >gb|EMT13069.1| hypothetical protein F775_11147 [Aegilops tauschii] Length = 141 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 22/46 (47%), Positives = 32/46 (69%) Frame = +3 Query: 6 KVLVSVTVGQSSGPLRVLICEDATVQDVMKEVISLYSKEGRRPSLP 143 ++LV+VTV +S P+ VL+ DATV D+ + + Y+ EGRRP LP Sbjct: 32 RLLVNVTVERSLWPVHVLLGSDATVADLARAAVDAYAAEGRRPPLP 77 Score = 28.1 bits (61), Expect(2) = 6e-06 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 157 DCLDAQAMIKDLGSRDFFMRLKEQTVKDD 243 D LD + + DLGSR+FF+ T+ D Sbjct: 99 DALDPEEKVLDLGSRNFFLCAARSTLGSD 127 >gb|EXC17848.1| hypothetical protein L484_023204 [Morus notabilis] Length = 137 Score = 48.9 bits (115), Expect(2) = 8e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +3 Query: 6 KVLVSVTVGQSSGPLRVLICEDATVQDVMKEVISLYSKEGRRPSLP 143 KVLV VTV +S G ++V++ + TV+D++KEV+ +Y+ E RRP LP Sbjct: 13 KVLVKVTVERSFGAVQVVVPTEETVKDLIKEVLKIYAAEKRRPLLP 58 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 154 FDCLDAQAMIKDLGSRDFFMRLKEQTVKDDCIATACTNGSS 276 F+ L+ + +LGSRDFF+ LK V D+ I +S Sbjct: 74 FESLNEDEKVINLGSRDFFLCLKR--VDDNMIVNTVNVNTS 112