BLASTX nr result
ID: Ephedra26_contig00006663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00006663 (453 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] 71 2e-10 gb|AFK48186.1| unknown [Lotus japonicus] 70 2e-10 ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like ... 70 2e-10 ref|XP_006488862.1| PREDICTED: 60S ribosomal protein L29-1-like ... 70 3e-10 gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus... 70 3e-10 ref|XP_006444476.1| hypothetical protein CICLE_v10023233mg [Citr... 70 3e-10 ref|XP_006419418.1| hypothetical protein CICLE_v10006499mg, part... 70 3e-10 ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatu... 70 3e-10 ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like ... 70 3e-10 ref|XP_006597712.1| PREDICTED: 60S ribosomal protein L29-1 [Glyc... 70 4e-10 ref|XP_002312342.1| 60S ribosomal protein L29 [Populus trichocar... 69 5e-10 ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 69 7e-10 ref|XP_004239876.1| PREDICTED: 60S ribosomal protein L29-2-like ... 69 9e-10 ref|NP_001042836.1| Os01g0304000 [Oryza sativa Japonica Group] g... 68 1e-09 ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like ... 68 1e-09 ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 68 1e-09 gb|AFK42911.1| unknown [Medicago truncatula] 68 1e-09 dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] 67 2e-09 ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus... 67 2e-09 ref|XP_002314927.2| hypothetical protein POPTR_0010s15190g, part... 67 3e-09 >gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] Length = 61 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK G + EE Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGESATEE 60 >gb|AFK48186.1| unknown [Lotus japonicus] Length = 61 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK GAES+ E Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNKK-GAESVTE 59 >ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356529227|ref|XP_003533197.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356564681|ref|XP_003550578.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] Length = 61 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK G + EE Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETATEE 60 >ref|XP_006488862.1| PREDICTED: 60S ribosomal protein L29-1-like [Citrus sinensis] Length = 60 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPKKHR+TSTKGMDPKFLRNQRYARKHNK+ G + EE Sbjct: 23 KPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 60 >gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gi|561027712|gb|ESW26352.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] Length = 61 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK G + EE Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETASEE 60 >ref|XP_006444476.1| hypothetical protein CICLE_v10023233mg [Citrus clementina] gi|567903978|ref|XP_006444477.1| hypothetical protein CICLE_v10023233mg [Citrus clementina] gi|568878696|ref|XP_006492322.1| PREDICTED: 60S ribosomal protein L29-2-like [Citrus sinensis] gi|557546738|gb|ESR57716.1| hypothetical protein CICLE_v10023233mg [Citrus clementina] gi|557546739|gb|ESR57717.1| hypothetical protein CICLE_v10023233mg [Citrus clementina] Length = 60 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPKKHR+TSTKGMDPKFLRNQRYARKHNK +G + EE Sbjct: 23 KPKKHRHTSTKGMDPKFLRNQRYARKHNKSNGGSAEEE 60 >ref|XP_006419418.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] gi|557521291|gb|ESR32658.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] Length = 88 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPKKHR+TSTKGMDPKFLRNQRYARKHNK+ G + EE Sbjct: 51 KPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 88 >ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatula] gi|355510808|gb|AES91950.1| 60S ribosomal protein L29 [Medicago truncatula] Length = 445 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK+G + EE Sbjct: 407 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEE 444 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDG 96 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK+G Sbjct: 159 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKNG 190 >ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502150865|ref|XP_004508162.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] gi|388515093|gb|AFK45608.1| unknown [Medicago truncatula] Length = 61 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK+G + EE Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEE 60 >ref|XP_006597712.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] Length = 61 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK G + EE Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGEIATEE 60 >ref|XP_002312342.1| 60S ribosomal protein L29 [Populus trichocarpa] gi|118484518|gb|ABK94134.1| unknown [Populus trichocarpa] gi|222852162|gb|EEE89709.1| 60S ribosomal protein L29 [Populus trichocarpa] Length = 61 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK G + EE Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKCGDSATEE 60 >ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147802163|emb|CAN65958.1| hypothetical protein VITISV_007494 [Vitis vinifera] gi|296083268|emb|CBI22904.3| unnamed protein product [Vitis vinifera] Length = 61 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KP+KHR+ STKGMDPKFLRNQRYARKHNKK G + EE Sbjct: 23 KPRKHRHASTKGMDPKFLRNQRYARKHNKKSGESATEE 60 >ref|XP_004239876.1| PREDICTED: 60S ribosomal protein L29-2-like [Solanum lycopersicum] Length = 60 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK HR++STKGMDPKFLRNQRYARKHNKK+G + EE Sbjct: 23 KPKSHRHSSTKGMDPKFLRNQRYARKHNKKNGETAAEE 60 >ref|NP_001042836.1| Os01g0304000 [Oryza sativa Japonica Group] gi|115463383|ref|NP_001055291.1| Os05g0355500 [Oryza sativa Japonica Group] gi|582044938|pdb|3J61|BB Chain b, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome gi|12060516|dbj|BAB20645.1| putative ribosomal protein L29 [Oryza sativa Japonica Group] gi|55168072|gb|AAV43940.1| putative 60S ribosomal protein L29 [Oryza sativa Japonica Group] gi|113532367|dbj|BAF04750.1| Os01g0304000 [Oryza sativa Japonica Group] gi|113578842|dbj|BAF17205.1| Os05g0355500 [Oryza sativa Japonica Group] gi|125525564|gb|EAY73678.1| hypothetical protein OsI_01562 [Oryza sativa Indica Group] gi|125551974|gb|EAY97683.1| hypothetical protein OsI_19605 [Oryza sativa Indica Group] gi|125570076|gb|EAZ11591.1| hypothetical protein OsJ_01455 [Oryza sativa Japonica Group] gi|215740427|dbj|BAG97083.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768402|dbj|BAH00631.1| unnamed protein product [Oryza sativa Japonica Group] gi|222631255|gb|EEE63387.1| hypothetical protein OsJ_18199 [Oryza sativa Japonica Group] Length = 60 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR TSTKGMDPKFLRNQRY+RKHNKK G EE Sbjct: 23 KPKRHRQTSTKGMDPKFLRNQRYSRKHNKKSGEAESEE 60 >ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502127331|ref|XP_004499659.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] Length = 61 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHN K+G + EE Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNNKNGEIATEE 60 >ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147811184|emb|CAN63474.1| hypothetical protein VITISV_016797 [Vitis vinifera] gi|297743968|emb|CBI36938.3| unnamed protein product [Vitis vinifera] Length = 62 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KP+KHR+TSTKGMDPKFLRNQRYARKHNKK + EE Sbjct: 23 KPRKHRHTSTKGMDPKFLRNQRYARKHNKKSEGSATEE 60 >gb|AFK42911.1| unknown [Medicago truncatula] Length = 61 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDG 96 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK+G Sbjct: 23 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKNG 54 >dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] Length = 61 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KP+KHR+TST+GMDPKFLRNQRYARKHN K G + EE Sbjct: 23 KPRKHRHTSTRGMDPKFLRNQRYARKHNNKTGESATEE 60 >ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus communis] gi|223541515|gb|EEF43064.1| 60S ribosomal protein L29, putative [Ricinus communis] Length = 61 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+ R+TSTKGMDPKFLRNQRYARKHNKK G + EE Sbjct: 23 KPKRQRHTSTKGMDPKFLRNQRYARKHNKKSGETATEE 60 >ref|XP_002314927.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] gi|550329855|gb|EEF01098.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] Length = 108 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 KPKKHRNTSTKGMDPKFLRNQRYARKHNKKDGAESIEE 114 KPK+HR+TSTKGMDPKFLRNQRYARKHNKK + EE Sbjct: 70 KPKRHRHTSTKGMDPKFLRNQRYARKHNKKCDETATEE 107