BLASTX nr result
ID: Ephedra26_contig00006651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00006651 (649 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC32732.1| Exocyst complex component 7 [Morus notabilis] 58 2e-06 ref|XP_002515352.1| protein binding protein, putative [Ricinus c... 57 5e-06 >gb|EXC32732.1| Exocyst complex component 7 [Morus notabilis] Length = 676 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/50 (56%), Positives = 33/50 (66%) Frame = -1 Query: 649 MQSYGPFVEQEENSKKYAKYSAADLEHMIFSVFQKGPGRLNKTKQNSYSG 500 MQ+YGP VEQ+ +S KYAKYS LE M+ S+F PGR N K S SG Sbjct: 610 MQNYGPLVEQDSSSSKYAKYSVQTLEKMLMSLFLTKPGRFNSFKGRSPSG 659 >ref|XP_002515352.1| protein binding protein, putative [Ricinus communis] gi|223545296|gb|EEF46801.1| protein binding protein, putative [Ricinus communis] Length = 683 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = -1 Query: 649 MQSYGPFVEQEENSKKYAKYSAADLEHMIFSVFQKGPGRLNKTKQNSYS 503 MQ+YGP VEQ+ +S KYAKYS LEHM+ S+FQ PGR K S Sbjct: 617 MQNYGPLVEQDGSSSKYAKYSVQTLEHMLASLFQPRPGRYGSFKGRQLS 665