BLASTX nr result
ID: Ephedra26_contig00006235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00006235 (560 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857829.1| hypothetical protein AMTR_s00069p00036320 [A... 58 2e-06 >ref|XP_006857829.1| hypothetical protein AMTR_s00069p00036320 [Amborella trichopoda] gi|548861931|gb|ERN19296.1| hypothetical protein AMTR_s00069p00036320 [Amborella trichopoda] Length = 1077 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/63 (44%), Positives = 35/63 (55%) Frame = -3 Query: 558 YCSNEFVDKLFEHVKHLCCGYKLVXXXXXXXXXXXXXXXXXXXXLRSILKASEFPVEIYD 379 YCSNEFVD+LF+ CCGYKLV LR+ LK+S+F V +Y+ Sbjct: 1009 YCSNEFVDQLFKFASQFCCGYKLVGAGGGGFALLLAKDKDRAKQLRNSLKSSDFNVTVYN 1068 Query: 378 WSI 370 WSI Sbjct: 1069 WSI 1071