BLASTX nr result
ID: Ephedra26_contig00005960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00005960 (598 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001784497.1| predicted protein [Physcomitrella patens] gi... 64 2e-08 ref|XP_006660850.1| PREDICTED: uncharacterized protein LOC102711... 62 9e-08 ref|XP_003562639.1| PREDICTED: uncharacterized protein LOC100836... 62 9e-08 gb|EEE59706.1| hypothetical protein OsJ_12133 [Oryza sativa Japo... 62 9e-08 gb|EEC75950.1| hypothetical protein OsI_13051 [Oryza sativa Indi... 62 9e-08 ref|NP_001050913.1| Os03g0683700 [Oryza sativa Japonica Group] g... 62 9e-08 ref|XP_004230039.1| PREDICTED: uncharacterized protein LOC101244... 62 2e-07 gb|AFW77583.1| hypothetical protein ZEAMMB73_404536, partial [Ze... 62 2e-07 gb|AFW77582.1| hypothetical protein ZEAMMB73_404536 [Zea mays] 62 2e-07 gb|AFW77581.1| hypothetical protein ZEAMMB73_404536, partial [Ze... 62 2e-07 ref|XP_006347850.1| PREDICTED: uncharacterized protein LOC102587... 61 2e-07 ref|XP_004957372.1| PREDICTED: uncharacterized protein LOC101769... 61 2e-07 gb|EMT16861.1| hypothetical protein F775_17073 [Aegilops tauschii] 61 2e-07 dbj|BAJ99465.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 2e-07 ref|XP_002440996.1| hypothetical protein SORBIDRAFT_09g018670 [S... 61 2e-07 ref|XP_002969734.1| hypothetical protein SELMODRAFT_92955 [Selag... 59 1e-06 ref|XP_002981341.1| hypothetical protein SELMODRAFT_114286 [Sela... 59 1e-06 ref|XP_004511052.1| PREDICTED: uncharacterized protein LOC101495... 58 2e-06 ref|XP_003627933.1| hypothetical protein MTR_8g040190 [Medicago ... 58 2e-06 ref|XP_006598088.1| PREDICTED: uncharacterized protein LOC100780... 58 2e-06 >ref|XP_001784497.1| predicted protein [Physcomitrella patens] gi|162663972|gb|EDQ50710.1| predicted protein [Physcomitrella patens] Length = 1088 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/58 (50%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -2 Query: 444 ADVELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNS 274 +D+EL+QRYRRDR ++LNF L++ ++ V +PPGA+S +DI Q+ V+++LECAR + Sbjct: 5 SDLELLQRYRRDRRELLNFLLSASVIKKVIMPPGAVSYDDIDLDQISVDYILECARKN 62 >ref|XP_006660850.1| PREDICTED: uncharacterized protein LOC102711458 [Oryza brachyantha] Length = 1108 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/57 (50%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR+ +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 7 VELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGE 63 >ref|XP_003562639.1| PREDICTED: uncharacterized protein LOC100836004 [Brachypodium distachyon] Length = 1109 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/57 (50%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR+ +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 7 VELLQRYRRDRHVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKRGE 63 >gb|EEE59706.1| hypothetical protein OsJ_12133 [Oryza sativa Japonica Group] Length = 1170 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/57 (50%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR+ +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 102 VELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGE 158 >gb|EEC75950.1| hypothetical protein OsI_13051 [Oryza sativa Indica Group] Length = 1160 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/57 (50%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR+ +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 92 VELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGE 148 >ref|NP_001050913.1| Os03g0683700 [Oryza sativa Japonica Group] gi|108710441|gb|ABF98236.1| expressed protein [Oryza sativa Japonica Group] gi|113549384|dbj|BAF12827.1| Os03g0683700 [Oryza sativa Japonica Group] Length = 1108 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/57 (50%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR+ +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 7 VELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGE 63 >ref|XP_004230039.1| PREDICTED: uncharacterized protein LOC101244034 [Solanum lycopersicum] Length = 1110 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/54 (55%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECAR 280 +EL+QR+RRDR +LNF L+ ++ V +PPGA+SLED+ QV V+FVL CAR Sbjct: 7 IELLQRFRRDRRILLNFILSGSLIKKVAMPPGAVSLEDVDLDQVSVDFVLNCAR 60 >gb|AFW77583.1| hypothetical protein ZEAMMB73_404536, partial [Zea mays] Length = 1034 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/57 (50%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 7 VELLQRYRRDRQVLLNYILSGNLIKKVAMPPGAISLDDVDIDQVSVDYVLNCAKKGE 63 >gb|AFW77582.1| hypothetical protein ZEAMMB73_404536 [Zea mays] Length = 1056 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/57 (50%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 7 VELLQRYRRDRQVLLNYILSGNLIKKVAMPPGAISLDDVDIDQVSVDYVLNCAKKGE 63 >gb|AFW77581.1| hypothetical protein ZEAMMB73_404536, partial [Zea mays] Length = 1014 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/57 (50%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 7 VELLQRYRRDRQVLLNYILSGNLIKKVAMPPGAISLDDVDIDQVSVDYVLNCAKKGE 63 >ref|XP_006347850.1| PREDICTED: uncharacterized protein LOC102587911, partial [Solanum tuberosum] Length = 1122 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/54 (55%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECAR 280 +EL+QR+RRDR +LNF L+ ++ V +PPGA+SLED+ QV V+FVL CAR Sbjct: 19 IELLQRFRRDRRILLNFILSGSLIKKVVMPPGAVSLEDVDLDQVSVDFVLNCAR 72 >ref|XP_004957372.1| PREDICTED: uncharacterized protein LOC101769141 [Setaria italica] Length = 1108 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/57 (50%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 7 VELLQRYRRDRQVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGE 63 >gb|EMT16861.1| hypothetical protein F775_17073 [Aegilops tauschii] Length = 575 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR+ +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ + Sbjct: 56 VELLQRYRRDRHVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGD 112 >dbj|BAJ99465.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 910 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR+ +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ + Sbjct: 7 VELLQRYRRDRHVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGD 63 >ref|XP_002440996.1| hypothetical protein SORBIDRAFT_09g018670 [Sorghum bicolor] gi|241946281|gb|EES19426.1| hypothetical protein SORBIDRAFT_09g018670 [Sorghum bicolor] Length = 1106 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/57 (50%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 VEL+QRYRRDR +LN+ L+ ++ V +PPGA+SL+D+ QV V++VL CA+ E Sbjct: 7 VELLQRYRRDRQVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGE 63 >ref|XP_002969734.1| hypothetical protein SELMODRAFT_92955 [Selaginella moellendorffii] gi|300162245|gb|EFJ28858.1| hypothetical protein SELMODRAFT_92955 [Selaginella moellendorffii] Length = 1091 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/52 (53%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -2 Query: 432 LMQRYRRDRYDILNFAL-ASGFLEVNVPPGALSLEDIAFVQVEVEFVLECAR 280 L+QRYRRDR ++L+F L AS F +V +PPGA++L+DI QV ++++LECA+ Sbjct: 2 LLQRYRRDRRELLSFILSASIFRKVVMPPGAVTLDDIDLEQVSIDYILECAK 53 >ref|XP_002981341.1| hypothetical protein SELMODRAFT_114286 [Selaginella moellendorffii] gi|300150881|gb|EFJ17529.1| hypothetical protein SELMODRAFT_114286 [Selaginella moellendorffii] Length = 1094 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/52 (53%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -2 Query: 432 LMQRYRRDRYDILNFAL-ASGFLEVNVPPGALSLEDIAFVQVEVEFVLECAR 280 L+QRYRRDR ++L+F L AS F +V +PPGA++L+DI QV ++++LECA+ Sbjct: 2 LLQRYRRDRRELLSFILSASIFRKVVMPPGAVTLDDIDLEQVSIDYILECAK 53 >ref|XP_004511052.1| PREDICTED: uncharacterized protein LOC101495068 [Cicer arietinum] Length = 1101 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/57 (45%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 ++L+QRYRRDR +L+F L+ ++ V +PPGA++L+D+ QV +++VL CA+ SE Sbjct: 7 IDLLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLNCAKKSE 63 >ref|XP_003627933.1| hypothetical protein MTR_8g040190 [Medicago truncatula] gi|355521955|gb|AET02409.1| hypothetical protein MTR_8g040190 [Medicago truncatula] Length = 1102 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/57 (45%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNSE 271 ++L+QRYRRDR +L+F L+ ++ V +PPGA++L+D+ QV +++VL CA+ SE Sbjct: 7 IDLLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLNCAKKSE 63 >ref|XP_006598088.1| PREDICTED: uncharacterized protein LOC100780877 isoform X1 [Glycine max] gi|571520965|ref|XP_006598089.1| PREDICTED: uncharacterized protein LOC100780877 isoform X2 [Glycine max] Length = 1104 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -2 Query: 438 VELMQRYRRDRYDILNFALASGFLE-VNVPPGALSLEDIAFVQVEVEFVLECARNS 274 +EL+QRYRRDR +L+F L+ ++ V +PPGA++L+D+ QV V++VL CA+ S Sbjct: 7 IELLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAKKS 62