BLASTX nr result
ID: Ephedra26_contig00005747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00005747 (579 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002457678.1| hypothetical protein SORBIDRAFT_03g011520 [S... 57 3e-06 ref|XP_003528735.1| PREDICTED: uncharacterized protein LOC100775... 56 6e-06 ref|XP_004510564.1| PREDICTED: uncharacterized protein LOC101514... 56 8e-06 ref|XP_003627441.1| hypothetical protein MTR_8g023050 [Medicago ... 56 8e-06 >ref|XP_002457678.1| hypothetical protein SORBIDRAFT_03g011520 [Sorghum bicolor] gi|241929653|gb|EES02798.1| hypothetical protein SORBIDRAFT_03g011520 [Sorghum bicolor] Length = 614 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/58 (44%), Positives = 41/58 (70%) Frame = -1 Query: 402 ELGSSVSARVNPSSFDSMTKVIYWLSDKDANSVKEQLKSLNLWLVDEDLSCTAIVCHR 229 ELG S S N S + + V++W K ++SV++QL++++LWLVD D SC+A+VCH+ Sbjct: 557 ELGPSTS---NRSISEDQSNVLFWSRSKASDSVQKQLENMDLWLVDSDSSCSAVVCHQ 611 >ref|XP_003528735.1| PREDICTED: uncharacterized protein LOC100775691 [Glycine max] Length = 617 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/57 (40%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = -1 Query: 393 SSVSARVNPSSFDSMT--KVIYWLSDKDANSVKEQLKSLNLWLVDEDLSCTAIVCHR 229 +S + ++ S S+ K++YW S+ + NS+++ L NLW +D DLSCTA+VCH+ Sbjct: 560 NSFATKIGSGSETSLRDKKLVYWSSEMELNSIQKWLDEFNLWSIDSDLSCTAVVCHK 616 >ref|XP_004510564.1| PREDICTED: uncharacterized protein LOC101514737 [Cicer arietinum] Length = 621 Score = 55.8 bits (133), Expect = 8e-06 Identities = 20/39 (51%), Positives = 32/39 (82%) Frame = -1 Query: 345 KVIYWLSDKDANSVKEQLKSLNLWLVDEDLSCTAIVCHR 229 K++YW ++ +S++++LK LNLW +D DLSCTA+VCH+ Sbjct: 582 KLVYWSTEVAPDSIQKRLKELNLWSIDSDLSCTAVVCHK 620 >ref|XP_003627441.1| hypothetical protein MTR_8g023050 [Medicago truncatula] gi|355521463|gb|AET01917.1| hypothetical protein MTR_8g023050 [Medicago truncatula] Length = 622 Score = 55.8 bits (133), Expect = 8e-06 Identities = 22/52 (42%), Positives = 39/52 (75%) Frame = -1 Query: 384 SARVNPSSFDSMTKVIYWLSDKDANSVKEQLKSLNLWLVDEDLSCTAIVCHR 229 S V+ SS + K++YW ++ + +S++++L+ LNLW +D +LSCTA+VCH+ Sbjct: 571 SGGVSKSSLEDK-KLVYWSTEMELDSIQKRLEELNLWSIDNELSCTAVVCHK 621