BLASTX nr result
ID: Ephedra26_contig00005657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00005657 (690 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24805.1| unknown [Picea sitchensis] 74 3e-11 >gb|ABK24805.1| unknown [Picea sitchensis] Length = 421 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +2 Query: 554 MEKAWEKAVESARGGRDTKDVTTLTLDGFLKGTPCKLPAAALFEQ 688 MEKAWEKAVE+ARGG++ ++ +LTLDG LKGTPC+LP AALFEQ Sbjct: 1 MEKAWEKAVEAARGGQNPSEIVSLTLDGALKGTPCRLPPAALFEQ 45