BLASTX nr result
ID: Ephedra26_contig00005580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00005580 (925 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK27104.1| unknown [Picea sitchensis] 85 3e-14 emb|CBI33546.3| unnamed protein product [Vitis vinifera] 70 1e-09 ref|XP_003633718.1| PREDICTED: uncharacterized protein LOC100243... 70 1e-09 ref|XP_006842687.1| hypothetical protein AMTR_s00147p00067470 [A... 66 2e-08 ref|XP_002966858.1| hypothetical protein SELMODRAFT_408071 [Sela... 65 3e-08 gb|AFG43295.1| hypothetical protein 2_1093_01, partial [Pinus ta... 65 5e-08 gb|AFG43287.1| hypothetical protein 2_1093_01, partial [Pinus ta... 65 5e-08 gb|AFG43286.1| hypothetical protein 2_1093_01, partial [Pinus ta... 65 5e-08 gb|AEW08147.1| hypothetical protein 2_1093_01, partial [Pinus ra... 65 5e-08 ref|XP_002961151.1| hypothetical protein SELMODRAFT_402807 [Sela... 63 1e-07 gb|AFG48702.1| hypothetical protein CL3131Contig1_04, partial [P... 62 2e-07 gb|AFG48690.1| hypothetical protein CL3131Contig1_04, partial [P... 62 2e-07 ref|XP_006842686.1| hypothetical protein AMTR_s00147p00064120 [A... 62 4e-07 gb|AEW09007.1| hypothetical protein CL3131Contig1_04, partial [P... 62 4e-07 gb|ABK26492.1| unknown [Picea sitchensis] gi|148909586|gb|ABR178... 61 5e-07 gb|ABK23021.1| unknown [Picea sitchensis] 61 5e-07 gb|AFG48701.1| hypothetical protein CL3131Contig1_04, partial [P... 60 9e-07 gb|EOY03997.1| Uncharacterized protein TCM_019235 [Theobroma cacao] 59 2e-06 ref|XP_002314888.2| hypothetical protein POPTR_0010s14060g [Popu... 59 3e-06 ref|XP_002524397.1| conserved hypothetical protein [Ricinus comm... 58 4e-06 >gb|ABK27104.1| unknown [Picea sitchensis] Length = 159 Score = 85.1 bits (209), Expect = 3e-14 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 3/103 (2%) Frame = +3 Query: 381 CTFHTRRHEVQEVKRKAGRLSHVFKKAMNLTRAKKALLGRRKGRTESQEAIYDEGL---P 551 C H R + + +H + +KK L+ ++ R E +EA YD Sbjct: 44 CAAHFHRRNAKNRGTTGFKFAHKLPGRALINSSKKFLISKKWRRNEEEEAAYDRAAMEEQ 103 Query: 552 AGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKS 680 G +++W+R ILMGERC+PP FSG I+YDDKGNRLP FP +S Sbjct: 104 EGGGDSVWQRSILMGERCQPPAFSGLIIYDDKGNRLPQFPPRS 146 >emb|CBI33546.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 70.1 bits (170), Expect = 1e-09 Identities = 41/107 (38%), Positives = 61/107 (57%), Gaps = 7/107 (6%) Frame = +3 Query: 378 MCTFH--TRRHEVQEVKRKAGRLSHVFKKAMNLTRAKKALL-----GRRKGRTESQEAIY 536 +C H T+ H+++E + G + +++N + KALL RK + E +E Y Sbjct: 69 LCASHRITKPHKLKEEGK--GAVKSKLVRSLNSNISSKALLMVKMVSWRKVQVEGEEGDY 126 Query: 537 DEGLPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVK 677 + DDE +W+R I+MGERCRP +FSG I YD +GN LP+ P K Sbjct: 127 NSD--GDDDEAVWKRTIMMGERCRPLDFSGKIAYDSQGNLLPNSPNK 171 >ref|XP_003633718.1| PREDICTED: uncharacterized protein LOC100243237 [Vitis vinifera] Length = 154 Score = 70.1 bits (170), Expect = 1e-09 Identities = 41/107 (38%), Positives = 61/107 (57%), Gaps = 7/107 (6%) Frame = +3 Query: 378 MCTFH--TRRHEVQEVKRKAGRLSHVFKKAMNLTRAKKALL-----GRRKGRTESQEAIY 536 +C H T+ H+++E + G + +++N + KALL RK + E +E Y Sbjct: 40 LCASHRITKPHKLKEEGK--GAVKSKLVRSLNSNISSKALLMVKMVSWRKVQVEGEEGDY 97 Query: 537 DEGLPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVK 677 + DDE +W+R I+MGERCRP +FSG I YD +GN LP+ P K Sbjct: 98 NSD--GDDDEAVWKRTIMMGERCRPLDFSGKIAYDSQGNLLPNSPNK 142 >ref|XP_006842687.1| hypothetical protein AMTR_s00147p00067470 [Amborella trichopoda] gi|548844788|gb|ERN04362.1| hypothetical protein AMTR_s00147p00067470 [Amborella trichopoda] Length = 126 Score = 66.2 bits (160), Expect = 2e-08 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 489 LLGRRKGRTESQEAIYDEGLPAGDDET---IWRRKILMGERCRPPNFSGAILYDDKGNRL 659 LL ++KG E + I+ E + ET +W+RKILMGE+C PP+FSG I YD GN+L Sbjct: 39 LLTKKKGNEEIGDQIHHETETETETETEEGLWQRKILMGEKCEPPDFSGVIYYDHMGNQL 98 Query: 660 PHFPVKS 680 FP KS Sbjct: 99 SQFPPKS 105 >ref|XP_002966858.1| hypothetical protein SELMODRAFT_408071 [Selaginella moellendorffii] gi|300164849|gb|EFJ31457.1| hypothetical protein SELMODRAFT_408071 [Selaginella moellendorffii] Length = 136 Score = 65.5 bits (158), Expect = 3e-08 Identities = 31/67 (46%), Positives = 45/67 (67%) Frame = +3 Query: 480 KKALLGRRKGRTESQEAIYDEGLPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRL 659 +KA L R + + Q+ ++ E A +W+R ILMGE+C PP+FSG ILYD++GNR+ Sbjct: 64 RKAALLRVEQQYRKQDDMFWENTGA-----VWQRTILMGEKCEPPDFSGLILYDERGNRV 118 Query: 660 PHFPVKS 680 P +P KS Sbjct: 119 PEYPAKS 125 >gb|AFG43295.1| hypothetical protein 2_1093_01, partial [Pinus taeda] Length = 139 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 4/75 (5%) Frame = +3 Query: 468 LTRAKKALLGRRKGRTESQEAI--YDEGL--PAGDDETIWRRKILMGERCRPPNFSGAIL 635 ++ ++K L+ ++ G + ++ + YD + G +++W+R IL+GE+C P NFSG I+ Sbjct: 60 ISGSRKLLISKKWGISGEEDEVNAYDRAVMQEEGGGDSLWQRNILLGEKCEPLNFSGTII 119 Query: 636 YDDKGNRLPHFPVKS 680 YDDKG +LP FP +S Sbjct: 120 YDDKGKQLPAFPPRS 134 >gb|AFG43287.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125468|gb|AFG43288.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125472|gb|AFG43290.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125478|gb|AFG43293.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125484|gb|AFG43296.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125486|gb|AFG43297.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125488|gb|AFG43298.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125490|gb|AFG43299.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125492|gb|AFG43300.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125494|gb|AFG43301.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125498|gb|AFG43303.1| hypothetical protein 2_1093_01, partial [Pinus taeda] Length = 139 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 4/75 (5%) Frame = +3 Query: 468 LTRAKKALLGRRKGRTESQEAI--YDEGL--PAGDDETIWRRKILMGERCRPPNFSGAIL 635 ++ ++K L+ ++ G + ++ + YD + G +++W+R IL+GE+C P NFSG I+ Sbjct: 60 ISGSRKLLISKKWGISGEEDEVNAYDRAVMQEEGGGDSLWQRNILLGEKCEPLNFSGTII 119 Query: 636 YDDKGNRLPHFPVKS 680 YDDKG +LP FP +S Sbjct: 120 YDDKGRQLPAFPPRS 134 >gb|AFG43286.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125474|gb|AFG43291.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125476|gb|AFG43292.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125480|gb|AFG43294.1| hypothetical protein 2_1093_01, partial [Pinus taeda] gi|383125496|gb|AFG43302.1| hypothetical protein 2_1093_01, partial [Pinus taeda] Length = 139 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 4/75 (5%) Frame = +3 Query: 468 LTRAKKALLGRRKGRTESQEAI--YDEGL--PAGDDETIWRRKILMGERCRPPNFSGAIL 635 ++ ++K L+ ++ G + ++ + YD + G +++W+R IL+GE+C P NFSG I+ Sbjct: 60 ISGSRKLLISKKWGISGEEDEVNAYDRAVMQEEGGGDSLWQRNILLGEKCEPLNFSGTII 119 Query: 636 YDDKGNRLPHFPVKS 680 YDDKG +LP FP +S Sbjct: 120 YDDKGKQLPAFPPRS 134 >gb|AEW08147.1| hypothetical protein 2_1093_01, partial [Pinus radiata] gi|383125470|gb|AFG43289.1| hypothetical protein 2_1093_01, partial [Pinus taeda] Length = 139 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 4/75 (5%) Frame = +3 Query: 468 LTRAKKALLGRRKGRTESQEAI--YDEGL--PAGDDETIWRRKILMGERCRPPNFSGAIL 635 ++ ++K L+ ++ G + ++ + YD + G +++W+R IL+GE+C P NFSG I+ Sbjct: 60 ISGSRKLLISKKWGISGEEDEVNAYDRAVMQEEGGGDSLWQRNILLGEKCEPLNFSGTII 119 Query: 636 YDDKGNRLPHFPVKS 680 YDDKG +LP FP +S Sbjct: 120 YDDKGKQLPAFPPRS 134 >ref|XP_002961151.1| hypothetical protein SELMODRAFT_402807 [Selaginella moellendorffii] gi|300172090|gb|EFJ38690.1| hypothetical protein SELMODRAFT_402807 [Selaginella moellendorffii] Length = 136 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/67 (44%), Positives = 44/67 (65%) Frame = +3 Query: 480 KKALLGRRKGRTESQEAIYDEGLPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRL 659 +KA L R + + Q+ ++ E A +W+R IL GE+C PP+FSG ILYD++GNR+ Sbjct: 64 RKAALLRVEQQYRKQDDMFWENTGA-----VWQRTILTGEKCEPPDFSGLILYDERGNRV 118 Query: 660 PHFPVKS 680 P +P KS Sbjct: 119 PEYPAKS 125 >gb|AFG48702.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] Length = 68 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +3 Query: 534 YDEG-LPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFP 671 YD + G +++W+R ILMGERC+PP+FSG ILYD KGNR+P P Sbjct: 9 YDRAAMEEGGGDSVWQRGILMGERCQPPDFSGIILYDVKGNRVPQLP 55 >gb|AFG48690.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135387|gb|AFG48691.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135388|gb|AFG48692.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135389|gb|AFG48693.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135390|gb|AFG48694.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135391|gb|AFG48695.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135392|gb|AFG48696.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135393|gb|AFG48697.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135394|gb|AFG48698.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135395|gb|AFG48699.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135396|gb|AFG48700.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135399|gb|AFG48703.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135400|gb|AFG48704.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135402|gb|AFG48706.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135403|gb|AFG48707.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] Length = 68 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +3 Query: 534 YDEG-LPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFP 671 YD + G +++W+R ILMGERC+PP+FSG ILYD KGNR+P P Sbjct: 9 YDRAAMEEGGGDSVWQRGILMGERCQPPDFSGIILYDVKGNRVPQLP 55 >ref|XP_006842686.1| hypothetical protein AMTR_s00147p00064120 [Amborella trichopoda] gi|548844787|gb|ERN04361.1| hypothetical protein AMTR_s00147p00064120 [Amborella trichopoda] Length = 124 Score = 61.6 bits (148), Expect = 4e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 561 DETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKS 680 D +IW+++IL+G RC+P FSGAI+YD GNRLP FP KS Sbjct: 77 DSSIWKKRILIGNRCKPLEFSGAIIYDSDGNRLPKFPPKS 116 >gb|AEW09007.1| hypothetical protein CL3131Contig1_04, partial [Pinus radiata] Length = 68 Score = 61.6 bits (148), Expect = 4e-07 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +3 Query: 534 YDEG-LPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFP 671 YD + G ++W+R ILMGERC+PP+FSG ILYD KGNR+P P Sbjct: 9 YDRAAMEEGGGNSVWQRGILMGERCQPPDFSGIILYDVKGNRVPQLP 55 >gb|ABK26492.1| unknown [Picea sitchensis] gi|148909586|gb|ABR17885.1| unknown [Picea sitchensis] Length = 154 Score = 61.2 bits (147), Expect = 5e-07 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = +3 Query: 510 RTESQEAIYDEGLPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKS 680 R +S +EG P+ +W++KI+MGERC+ P FSG ILYD++GN LPH KS Sbjct: 96 REDSVAVAVEEGAPSATPP-VWKKKIMMGERCQLPKFSGLILYDEQGNALPHAKKKS 151 >gb|ABK23021.1| unknown [Picea sitchensis] Length = 154 Score = 61.2 bits (147), Expect = 5e-07 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = +3 Query: 510 RTESQEAIYDEGLPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKS 680 R +S +EG P+ +W++KI+MGERC+ P FSG ILYD++GN LPH KS Sbjct: 96 REDSVAVAVEEGAPSATPP-VWKKKIMMGERCQLPKFSGLILYDEQGNALPHAKKKS 151 >gb|AFG48701.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] gi|383135401|gb|AFG48705.1| hypothetical protein CL3131Contig1_04, partial [Pinus taeda] Length = 68 Score = 60.5 bits (145), Expect = 9e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 564 ETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFP 671 +++W+R ILMGERC+PP+FSG ILYD KGNR+P P Sbjct: 20 DSVWQRGILMGERCQPPDFSGIILYDVKGNRVPQLP 55 >gb|EOY03997.1| Uncharacterized protein TCM_019235 [Theobroma cacao] Length = 139 Score = 59.3 bits (142), Expect = 2e-06 Identities = 31/92 (33%), Positives = 49/92 (53%) Frame = +3 Query: 387 FHTRRHEVQEVKRKAGRLSHVFKKAMNLTRAKKALLGRRKGRTESQEAIYDEGLPAGDDE 566 F +++ + + + LS + + + ++ RK + E +E G DE Sbjct: 50 FQRQKNNEESMSSERKLLSKMNSNLGSKAQLMVKMISWRKRQAEEEEDYN------GSDE 103 Query: 567 TIWRRKILMGERCRPPNFSGAILYDDKGNRLP 662 +WR+ I+MGERCRP +FSG ILYD +GN LP Sbjct: 104 AVWRKTIIMGERCRPLDFSGKILYDSQGNLLP 135 >ref|XP_002314888.2| hypothetical protein POPTR_0010s14060g [Populus trichocarpa] gi|550329773|gb|EEF01059.2| hypothetical protein POPTR_0010s14060g [Populus trichocarpa] Length = 178 Score = 58.5 bits (140), Expect = 3e-06 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = +3 Query: 558 DDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKSRA 686 +++ +W++ ILMGE+C+PP FSG I YD +GN+LP P RA Sbjct: 112 EEDGLWQKSILMGEKCQPPEFSGVIFYDGRGNQLPQMPRSPRA 154 >ref|XP_002524397.1| conserved hypothetical protein [Ricinus communis] gi|223536358|gb|EEF38008.1| conserved hypothetical protein [Ricinus communis] Length = 165 Score = 58.2 bits (139), Expect = 4e-06 Identities = 36/114 (31%), Positives = 51/114 (44%), Gaps = 11/114 (9%) Frame = +3 Query: 378 MCTFHTRRHEVQEVKRKA----GRLSHVFKKAMNLTRAKKALLGRRKGRTESQEAIYDEG 545 +C HTR+H K + S + R + K + S + + G Sbjct: 35 LCAKHTRKHPETSNKIRVTTPTNNKSPLASPKNLAARISNKAIDPFKKKDSSDDQGGEAG 94 Query: 546 LPAGDDET-------IWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKSRA 686 + A + E +W++ ILMGE+CRPP FSG I YD GN+LP P RA Sbjct: 95 IGAKEMEGDGFGEGGLWQKSILMGEKCRPPEFSGVIYYDSHGNQLPEMPRSPRA 148