BLASTX nr result
ID: Ephedra26_contig00005222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00005222 (635 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW08930.1| hypothetical protein CL2315Contig1_03, partial [P... 91 2e-16 gb|ABR16645.1| unknown [Picea sitchensis] 90 6e-16 >gb|AEW08930.1| hypothetical protein CL2315Contig1_03, partial [Pinus radiata] gi|383138998|gb|AFG50719.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139000|gb|AFG50720.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139002|gb|AFG50721.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139004|gb|AFG50722.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139006|gb|AFG50723.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139008|gb|AFG50724.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139010|gb|AFG50725.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139012|gb|AFG50726.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139014|gb|AFG50727.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139016|gb|AFG50728.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139018|gb|AFG50729.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139020|gb|AFG50730.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139022|gb|AFG50731.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139024|gb|AFG50732.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139026|gb|AFG50733.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139028|gb|AFG50734.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139030|gb|AFG50735.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] gi|383139032|gb|AFG50736.1| hypothetical protein CL2315Contig1_03, partial [Pinus taeda] Length = 80 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/79 (54%), Positives = 59/79 (74%) Frame = +3 Query: 3 AENNHMLTKLNMASQKFLQIEDENAKMRTYASDLNTRLQSLNMVLQWAGLLNELDCGSSP 182 AEN+HMLTK N+ASQK++Q+E+EN+ +R+YA DL+ +LQSL M +QWAG+LN++D GSS Sbjct: 2 AENSHMLTKFNIASQKYMQLEEENSLLRSYAMDLSLKLQSLTMAMQWAGVLNDVDLGSST 61 Query: 183 EYDYDIIDPNSCLLNPFDH 239 + D D SC L H Sbjct: 62 GF-IDTTDIKSCYLPSISH 79 >gb|ABR16645.1| unknown [Picea sitchensis] Length = 173 Score = 89.7 bits (221), Expect = 6e-16 Identities = 47/95 (49%), Positives = 65/95 (68%) Frame = +3 Query: 3 AENNHMLTKLNMASQKFLQIEDENAKMRTYASDLNTRLQSLNMVLQWAGLLNELDCGSSP 182 AENNHMLTK N+AS K++Q+E+EN+ +R+YA+DL+ +LQSL + +QWAG+LN++D SS Sbjct: 87 AENNHMLTKFNIASHKYMQLEEENSLLRSYATDLSLKLQSLTIAMQWAGVLNDMDLDSST 146 Query: 183 EYDYDIIDPNSCLLNPFDHKQSYFSHLPTATEIYQ 287 + D D SC L S T+TEIYQ Sbjct: 147 GF-MDTTDIKSCYL-------PSISQPLTSTEIYQ 173