BLASTX nr result
ID: Ephedra26_contig00005007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00005007 (465 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK26029.1| unknown [Picea sitchensis] 145 7e-33 gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrh... 75 9e-12 gb|ADL36795.1| NAC domain class transcription factor [Malus dome... 74 2e-11 gb|ABB72842.1| NAC protein 1 [Elaeis guineensis] gi|82400211|gb|... 74 2e-11 ref|XP_003564785.1| PREDICTED: NAC domain-containing protein 48-... 74 2e-11 gb|EXB60108.1| NAC domain-containing protein 2 [Morus notabilis] 73 4e-11 ref|XP_006472812.1| PREDICTED: NAC domain-containing protein 2-l... 73 4e-11 ref|XP_006434240.1| hypothetical protein CICLE_v10001976mg [Citr... 73 4e-11 gb|AEF32523.1| stress-related NAM transcription factor [Elymus r... 73 4e-11 gb|AED99725.1| stress-related NAC transcription factor [Elymus r... 73 4e-11 gb|AGM34010.1| abscisic-acid-responsive NAC transcription factor... 72 6e-11 gb|EMT29472.1| NAC domain-containing protein 48 [Aegilops tauschii] 72 6e-11 gb|ADE59454.1| NAC transcription factor 6D [Triticum aestivum] g... 72 6e-11 dbj|BAJ94096.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 6e-11 gb|ADE34581.1| NAC transcription factor 6 [Triticum aestivum] 72 6e-11 gb|ADE59453.1| NAC transcription factor 6B [Triticum aestivum] g... 72 6e-11 ref|XP_002520341.1| NAC domain-containing protein, putative [Ric... 72 6e-11 emb|CAM57978.1| NAC transcription factor [Hordeum vulgare subsp.... 72 6e-11 gb|AHJ38168.1| NAC domain transcription factor 1 [Citrullus colo... 72 8e-11 gb|ADE59452.1| NAC transcription factor 6A [Triticum aestivum] g... 72 8e-11 >gb|ABK26029.1| unknown [Picea sitchensis] Length = 387 Score = 145 bits (365), Expect = 7e-33 Identities = 89/169 (52%), Positives = 106/169 (62%), Gaps = 15/169 (8%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQKEWSVNXXXXXXXXX 284 IMHEYRLA+VNRSAKKKGSLRLDDWVLCRIYNKKSS +KLAKE QKEWS Sbjct: 133 IMHEYRLADVNRSAKKKGSLRLDDWVLCRIYNKKSSAEKLAKE-QKEWSSEEAMEQFHEE 191 Query: 283 XXXEM-----LHSHSGNINFEH----SQDSTKCAPSPDCTTTSVQDSKVSAVTN---PMN 140 ++ + N + EH SQDST APSP+C T S DS+ SA+T+ N Sbjct: 192 IDEKVPGILPTGNTIMNSSIEHSERTSQDSTISAPSPNCRTASNHDSRASAITSLSYNSN 251 Query: 139 PYFQ---NQKHNNGYPMEHTELAPLFSSMLNSRSTYDRSDLVAPPLLMT 2 P F+ N + PME EL P FSSM N R+ YD +DL+ PP+L+T Sbjct: 252 PIFEQNLNLSNARSAPMEIPELVPFFSSMNNHRTNYDSADLI-PPILLT 299 >gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrhiza] Length = 292 Score = 75.1 bits (183), Expect = 9e-12 Identities = 54/157 (34%), Positives = 80/157 (50%), Gaps = 23/157 (14%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKL----AKEQQKEWSVNXXXXX 296 IMHEYRLA V+RSA K+ +LRLDDWVLCRIYNKK +++K KE Q S + Sbjct: 128 IMHEYRLANVDRSAGKRSNLRLDDWVLCRIYNKKRTLEKHYNVDEKEVQFSDSEDQKPNV 187 Query: 295 XXXXXXXEMLHSH-----SGNINFEHSQDSTKCAPSPDCTTTSVQDSKVSAVT--NPMNP 137 M++ + S ++ H+ DS+ +P + V D +V + + + + Sbjct: 188 NSVMAAPPMMNEYMHFETSESMPKWHATDSSSSEHAPSSSPEFVCDKEVESRSKWSEFDT 247 Query: 136 Y------------FQNQKHNNGYPMEHTELAPLFSSM 62 Y FQ+ +N G M++T+ PLFS M Sbjct: 248 YLDTQLNFMDAGGFQDNFYNAGAQMQYTDQFPLFSDM 284 >gb|ADL36795.1| NAC domain class transcription factor [Malus domestica] Length = 306 Score = 74.3 bits (181), Expect = 2e-11 Identities = 39/88 (44%), Positives = 52/88 (59%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQKEWSVNXXXXXXXXX 284 IMHEYRLA+V+RS +KK SLRLDDWVLCRIYNKK +V+ +QQ+E Sbjct: 136 IMHEYRLADVDRSPRKKNSLRLDDWVLCRIYNKKGTVENQQPQQQQE------------Q 183 Query: 283 XXXEMLHSHSGNINFEHSQDSTKCAPSP 200 ++ SG+ + D+ +C P P Sbjct: 184 QRTTSRNASSGSEFEDRKPDNLRCPPPP 211 >gb|ABB72842.1| NAC protein 1 [Elaeis guineensis] gi|82400211|gb|ABB72844.1| NAC protein 1 splice variant 2 [Elaeis guineensis] Length = 303 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQKE 323 IMHEYRLA+ NR+A KKGSLRLDDWVLCR+YNKK++ +K+ +QQKE Sbjct: 135 IMHEYRLADTNRAANKKGSLRLDDWVLCRLYNKKNTWEKM--QQQKE 179 >ref|XP_003564785.1| PREDICTED: NAC domain-containing protein 48-like [Brachypodium distachyon] Length = 292 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A QK Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGLEKPAAADQK 172 >gb|EXB60108.1| NAC domain-containing protein 2 [Morus notabilis] Length = 293 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDK 347 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK S++K Sbjct: 125 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGSIEK 163 >ref|XP_006472812.1| PREDICTED: NAC domain-containing protein 2-like [Citrus sinensis] Length = 302 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDK 347 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK S++K Sbjct: 125 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGSIEK 163 >ref|XP_006434240.1| hypothetical protein CICLE_v10001976mg [Citrus clementina] gi|557536362|gb|ESR47480.1| hypothetical protein CICLE_v10001976mg [Citrus clementina] Length = 302 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDK 347 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK S++K Sbjct: 125 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGSIEK 163 >gb|AEF32523.1| stress-related NAM transcription factor [Elymus repens] Length = 298 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQKEWSV 314 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K +V Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGMEKPASVDRKPATV 176 >gb|AED99725.1| stress-related NAC transcription factor [Elymus repens] Length = 299 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQKEWSV 314 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K +V Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGMEKPASVDRKPATV 176 >gb|AGM34010.1| abscisic-acid-responsive NAC transcription factor, partial [Lophopyrum elongatum] Length = 272 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGMEKPASVDRK 172 >gb|EMT29472.1| NAC domain-containing protein 48 [Aegilops tauschii] Length = 236 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGMEKPASVDRK 172 >gb|ADE59454.1| NAC transcription factor 6D [Triticum aestivum] gi|334352604|emb|CAZ39602.1| NAC transcription factor [Triticum aestivum] Length = 299 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGMEKPASVDRK 172 >dbj|BAJ94096.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 304 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGMEKPASVDRK 172 >gb|ADE34581.1| NAC transcription factor 6 [Triticum aestivum] Length = 298 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGLEKPASVDRK 172 >gb|ADE59453.1| NAC transcription factor 6B [Triticum aestivum] gi|296044564|gb|ADG85702.1| putative NAC transcription factor [Triticum aestivum] gi|334352602|emb|CAZ39601.1| NAC transcription factor [Triticum aestivum] Length = 298 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGLEKPASVDRK 172 >ref|XP_002520341.1| NAC domain-containing protein, putative [Ricinus communis] gi|223540560|gb|EEF42127.1| NAC domain-containing protein, putative [Ricinus communis] Length = 369 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQKE 323 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK +++K + K+ Sbjct: 203 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGTIEKQGQLSNKK 249 >emb|CAM57978.1| NAC transcription factor [Hordeum vulgare subsp. vulgare] Length = 304 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGMEKPASVDRK 172 >gb|AHJ38168.1| NAC domain transcription factor 1 [Citrullus colocynthis] Length = 299 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQKEWSVN 311 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K ++Q + S+N Sbjct: 125 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGVIEK--QQQLQNVSIN 173 >gb|ADE59452.1| NAC transcription factor 6A [Triticum aestivum] gi|334352600|emb|CAZ39600.1| NAC transcription factor [Triticum aestivum] Length = 299 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 463 IMHEYRLAEVNRSAKKKGSLRLDDWVLCRIYNKKSSVDKLAKEQQK 326 IMHEYRLA+V+RSA+KK SLRLDDWVLCRIYNKK ++K A +K Sbjct: 127 IMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGMEKPAAVDRK 172