BLASTX nr result
ID: Ephedra26_contig00004932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00004932 (1186 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836753.1| hypothetical protein AMTR_s00088p00152700 [A... 59 4e-06 >ref|XP_006836753.1| hypothetical protein AMTR_s00088p00152700 [Amborella trichopoda] gi|548839313|gb|ERM99606.1| hypothetical protein AMTR_s00088p00152700 [Amborella trichopoda] Length = 913 Score = 58.9 bits (141), Expect = 4e-06 Identities = 63/237 (26%), Positives = 100/237 (42%), Gaps = 4/237 (1%) Frame = -3 Query: 1058 VSNLKNLCKLGGLVELKMEGTPNKLSSSHLALLTNLWELKLIIEDQQTADA-ISRNALSA 882 ++NL+ L +GG E E LL KL IE Q++ D + ++ Sbjct: 664 LANLQTLKYIGGNSEFVRE------------LLCLKQMRKLYIELQRSEDGGVLWESIQK 711 Query: 881 LKKLRCLALS--HYSKGAAVLELDDNMPEMLKDLHYLL-IYGFKLPKSISHFTQLQTLIL 711 + L CL +S + V + + P L+ L + KLP + L L+L Sbjct: 712 MDSLHCLRISCMDLDEALPVHIVAQSPPTTLERLGLSCGLPSGKLPNWVESLPCLSRLVL 771 Query: 710 DDIHVEDYGELGLERLPCLAHLVICRGKCEEFPESVGKAGAFPRLVDLQLYGFPNLKKMP 531 + + + L L+RLP L L + R ++ AG FP+L L L G ++ Sbjct: 772 EHSKLTEDPFLVLQRLPNLMDLTLHRASYLGNRTAICGAGGFPKLHRLVLIGLEEWEEWG 831 Query: 530 SIEEGGMPCLKSAFLGRCPNLRDGEGKDSLIAFFDAVVTLNEVAVSSFPDEFLQFLK 360 +EEG MPCL+ ++ C LR +L F + L + + DEFL L+ Sbjct: 832 EVEEGAMPCLQRVYIWNCRKLR------ALPQGFQYLTALQLLNLEEVGDEFLSRLE 882