BLASTX nr result
ID: Ephedra26_contig00004711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00004711 (438 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE75886.1| unknown [Picea sitchensis] 57 3e-06 >gb|ADE75886.1| unknown [Picea sitchensis] Length = 185 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -3 Query: 412 IQSHAVSLSIAAGIEQMQQSISQEAQFTPELQSVLLHQVMNLTQEQINSLPPD 254 + S S G+ Q QQ S AQ TPEL+S LL QVM+LT EQINSLPPD Sbjct: 120 VHSQGPSQMPVEGMSQPQQPPSHGAQLTPELESALLQQVMSLTPEQINSLPPD 172