BLASTX nr result
ID: Ephedra26_contig00004045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00004045 (532 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001784516.1| predicted protein [Physcomitrella patens] gi... 58 2e-06 >ref|XP_001784516.1| predicted protein [Physcomitrella patens] gi|162663944|gb|EDQ50683.1| predicted protein [Physcomitrella patens] Length = 664 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 109 KCKNRQKLVTRETKQLENVLAHPAFSANPFAAIQQHLEILLAPQL 243 + K +Q +VT ETKQL VL+HP F ANPFAAIQQHL L P L Sbjct: 181 RSKAKQTIVTNETKQLAAVLSHPQFKANPFAAIQQHLTTTLPPPL 225