BLASTX nr result
ID: Ephedra26_contig00003494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00003494 (491 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853801.1| hypothetical protein AMTR_s00056p00219450 [A... 57 3e-06 >ref|XP_006853801.1| hypothetical protein AMTR_s00056p00219450 [Amborella trichopoda] gi|548857462|gb|ERN15268.1| hypothetical protein AMTR_s00056p00219450 [Amborella trichopoda] Length = 849 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 1/80 (1%) Frame = -3 Query: 483 VSNLPTHLEYLDITNCPNLQRVSNLPTHLKSFCMVYCESVEVI-DISGLHSLVQLYVTGC 307 + LPT L YLD+++C NL + NL T L+S +C S+++I D+S L L +L +T C Sbjct: 650 IPELPTSLNYLDVSHCVNLLAIGNLSTTLESLKASHCISLQIIPDLSQLSQLEELDLTDC 709 Query: 306 TGLKSIIGLIRQDGIYSVTT 247 GL I GL G+ S+ T Sbjct: 710 KGLIEIQGL---SGLKSLKT 726