BLASTX nr result
ID: Ephedra26_contig00003414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00003414 (482 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG58881.1| hypothetical protein CL102Contig2_01, partial [Pi... 58 1e-06 gb|ABR18422.1| unknown [Picea sitchensis] 58 1e-06 >gb|AFG58881.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153489|gb|AFG58882.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153491|gb|AFG58883.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153493|gb|AFG58884.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153495|gb|AFG58885.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153497|gb|AFG58886.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153499|gb|AFG58887.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153501|gb|AFG58888.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153503|gb|AFG58889.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153505|gb|AFG58890.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153507|gb|AFG58891.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153509|gb|AFG58892.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153511|gb|AFG58893.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153513|gb|AFG58894.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153515|gb|AFG58895.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153517|gb|AFG58896.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153519|gb|AFG58897.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] gi|383153521|gb|AFG58898.1| hypothetical protein CL102Contig2_01, partial [Pinus taeda] Length = 71 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/53 (58%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +2 Query: 5 GWVQPQQ-DPSQWNXXXXXXXXXXXXXXXXXXPPQPQDPNMYSYAPYATYGNY 160 GWVQPQQ DP+QWN PQPQDPNMYSYAPYA YGNY Sbjct: 19 GWVQPQQPDPNQWNGAYYGYGQGYDAGYGYA--PQPQDPNMYSYAPYA-YGNY 68 >gb|ABR18422.1| unknown [Picea sitchensis] Length = 418 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/53 (58%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +2 Query: 5 GWVQPQQ-DPSQWNXXXXXXXXXXXXXXXXXXPPQPQDPNMYSYAPYATYGNY 160 GWVQPQQ DP+QWN P QPQDPNMYSYAPYA YGNY Sbjct: 365 GWVQPQQPDPNQWNGAAYYGYGQGYDAGYGYAP-QPQDPNMYSYAPYA-YGNY 415