BLASTX nr result
ID: Ephedra26_contig00003370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00003370 (434 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHA44832.1| 1-hydroxy-2-methyl-2-E-butenyl 4-diphosphate redu... 82 6e-14 gb|ABB78088.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 82 6e-14 gb|ACN40284.1| unknown [Picea sitchensis] 80 2e-13 gb|ABO26587.1| type 1 1-hydroxy-2-methyl-2-(E)-butenyl-4-phospha... 79 6e-13 gb|AFG44784.1| hypothetical protein CL3614Contig1_03, partial [P... 77 2e-12 gb|ACC54560.1| putative 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho... 76 4e-12 gb|AFN02125.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 74 2e-11 ref|XP_004507401.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 74 3e-11 gb|AFK94154.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 73 3e-11 gb|ACM79143.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 73 3e-11 gb|AGJ03149.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 72 8e-11 gb|AFQ95412.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 72 8e-11 gb|AEZ55669.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 72 8e-11 gb|ACX54449.1| LYTB-like protein 1 [Epipremnum aureum] 72 8e-11 gb|EXB63620.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 72 1e-10 ref|XP_002960319.1| hypothetical protein SELMODRAFT_163924 [Sela... 72 1e-10 gb|ABB88836.2| IPP/DMAPP synthase [Stevia rebaudiana] 72 1e-10 gb|ABU44490.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 71 1e-10 gb|ABB78090.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 71 1e-10 gb|ABC84344.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 71 1e-10 >gb|AHA44832.1| 1-hydroxy-2-methyl-2-E-butenyl 4-diphosphate reductase [Larix kaempferi] Length = 485 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 SYGEL EKENWLP GPLKIGITSGASTPDK +EDVL +VFKMK+ EA Sbjct: 435 SYGELVEKENWLPTGPLKIGITSGASTPDKILEDVLKVVFKMKDEEA 481 >gb|ABB78088.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase type 1 [Ginkgo biloba] Length = 487 Score = 82.4 bits (202), Expect = 6e-14 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEAEALQPL 161 SYGEL EKENWLP GP+KIGITSGASTPDK +EDVL LVFK+K +ALQPL Sbjct: 437 SYGELVEKENWLPPGPIKIGITSGASTPDKILEDVLELVFKLK--HEDALQPL 487 >gb|ACN40284.1| unknown [Picea sitchensis] Length = 485 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 S+GEL EKENWLP GPLKIGITSGASTPDK +EDVL +VFKMK+ EA Sbjct: 435 SHGELVEKENWLPTGPLKIGITSGASTPDKILEDVLKVVFKMKDEEA 481 >gb|ABO26587.1| type 1 1-hydroxy-2-methyl-2-(E)-butenyl-4-phosphate reductase [Pinus taeda] Length = 485 Score = 79.0 bits (193), Expect = 6e-13 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 S+GEL EKENWLP GPLKIGITSGASTPDK +ED L +VFKMK+ EA Sbjct: 435 SHGELVEKENWLPTGPLKIGITSGASTPDKILEDTLKVVFKMKDEEA 481 >gb|AFG44784.1| hypothetical protein CL3614Contig1_03, partial [Pinus taeda] Length = 74 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAE 140 S+GEL EKENWLP GPLKIGITSGASTPDK +ED L +VFKMK+ E Sbjct: 29 SHGELVEKENWLPTGPLKIGITSGASTPDKILEDTLKVVFKMKDEE 74 >gb|ACC54560.1| putative 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase type 1 [Pinus densiflora] Length = 485 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 S+GEL KENWLP GPLKIGITSGASTPDK +ED L +VFKMK+ EA Sbjct: 435 SHGELVGKENWLPTGPLKIGITSGASTPDKILEDTLKVVFKMKDEEA 481 >gb|AFN02125.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Huperzia carinata] Length = 478 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 ++GEL EKE+WLPQGP+ IG+TSGASTPDK +EDVLN VF++K EA Sbjct: 425 NHGELVEKEDWLPQGPVTIGVTSGASTPDKVVEDVLNTVFQLKSEEA 471 >ref|XP_004507401.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Cicer arietinum] Length = 448 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 ++GEL EKENWLP+GPLKIG+TSGASTPDK +EDVL VF +K EA Sbjct: 398 NHGELVEKENWLPKGPLKIGVTSGASTPDKAVEDVLIKVFDLKREEA 444 >gb|AFK94154.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Dunaliella salina] Length = 474 Score = 73.2 bits (178), Expect = 3e-11 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = +3 Query: 6 YGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEAEALQP 158 YGELK ENWLP+GP+ IG+TSGASTPD+ +E+VL VF+MK+ + +QP Sbjct: 413 YGELKVTENWLPEGPITIGVTSGASTPDRAVEEVLERVFRMKDPNFKGIQP 463 >gb|ACM79143.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Dunaliella salina] Length = 474 Score = 73.2 bits (178), Expect = 3e-11 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = +3 Query: 6 YGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEAEALQP 158 YGELK ENWLP+GP+ IG+TSGASTPD+ +E+VL VF+MK+ + +QP Sbjct: 413 YGELKVTENWLPEGPITIGVTSGASTPDRAVEEVLERVFRMKDPNFKGIQP 463 >gb|AGJ03149.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Salvia miltiorrhiza f. alba] Length = 463 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = +3 Query: 6 YGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAE 140 +GEL EKENW+P+GP+ IG+TSGASTPDK ++DVL VF+MK+AE Sbjct: 414 HGELVEKENWMPEGPVTIGVTSGASTPDKVVQDVLEKVFEMKQAE 458 >gb|AFQ95412.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salvia miltiorrhiza] Length = 463 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = +3 Query: 6 YGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAE 140 +GEL EKENW+P+GP+ IG+TSGASTPDK ++DVL VF+MK+AE Sbjct: 414 HGELVEKENWMPEGPVTIGVTSGASTPDKVVQDVLEKVFEMKQAE 458 >gb|AEZ55669.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 [Salvia miltiorrhiza] Length = 463 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = +3 Query: 6 YGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAE 140 +GEL EKENW+P+GP+ IG+TSGASTPDK ++DVL VF+MK+AE Sbjct: 414 HGELVEKENWMPEGPVTIGVTSGASTPDKVVQDVLEKVFEMKQAE 458 >gb|ACX54449.1| LYTB-like protein 1 [Epipremnum aureum] Length = 204 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 ++GEL EKENWLP GP+ IGITSGASTPDK +EDVL VFK+K EA Sbjct: 154 NHGELVEKENWLPPGPITIGITSGASTPDKVVEDVLVKVFKLKREEA 200 >gb|EXB63620.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Morus notabilis] Length = 497 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 ++GEL EKENWLP+GPL IGITSGASTPDK +EDVL VF +K EA Sbjct: 447 NHGELVEKENWLPKGPLMIGITSGASTPDKAVEDVLIKVFDLKREEA 493 >ref|XP_002960319.1| hypothetical protein SELMODRAFT_163924 [Selaginella moellendorffii] gi|300171258|gb|EFJ37858.1| hypothetical protein SELMODRAFT_163924 [Selaginella moellendorffii] Length = 468 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 ++GEL EKENWLP GP+ IGITSGASTPDK +EDVL VF++K+ EA Sbjct: 420 NHGELVEKENWLPTGPVTIGITSGASTPDKVVEDVLKQVFQLKKQEA 466 >gb|ABB88836.2| IPP/DMAPP synthase [Stevia rebaudiana] Length = 458 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +3 Query: 6 YGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 +GEL EKENWLP+GPL IGITSGASTPDK +EDVL VF++K E+ Sbjct: 409 HGELVEKENWLPKGPLTIGITSGASTPDKAVEDVLKRVFEIKREES 454 >gb|ABU44490.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Taxus x media] Length = 474 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAEA 143 ++GEL EK+NWLP+GP+ IGITSGASTPDK +EDVL VF++K EA Sbjct: 424 NHGELVEKDNWLPEGPITIGITSGASTPDKVVEDVLRKVFEIKREEA 470 >gb|ABB78090.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase type 3 [Ginkgo biloba] Length = 474 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAE 140 ++GEL EKENWLP+GP+ IG+TSGASTPDK +EDVL VF++K+ E Sbjct: 424 NHGELVEKENWLPEGPITIGVTSGASTPDKVVEDVLKRVFQIKQEE 469 >gb|ABC84344.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Ginkgo biloba] Length = 474 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = +3 Query: 3 SYGELKEKENWLPQGPLKIGITSGASTPDKKMEDVLNLVFKMKEAE 140 ++GEL EKENWLP+GP+ IG+TSGASTPDK +EDVL VF++K+ E Sbjct: 424 NHGELVEKENWLPEGPITIGVTSGASTPDKVVEDVLKRVFQIKQEE 469