BLASTX nr result
ID: Ephedra26_contig00003287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00003287 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22098.1| unknown [Picea sitchensis] 112 5e-23 ref|XP_001756061.1| predicted protein [Physcomitrella patens] gi... 93 3e-17 ref|WP_017656125.1| hypothetical protein [Microchaete sp. PCC 7126] 55 1e-05 ref|YP_002374128.1| hypothetical protein PCC8801_4033 [Cyanothec... 55 1e-05 >gb|ABK22098.1| unknown [Picea sitchensis] Length = 140 Score = 112 bits (280), Expect = 5e-23 Identities = 69/144 (47%), Positives = 90/144 (62%), Gaps = 11/144 (7%) Frame = +2 Query: 95 MAATSAMLHTLPS-HTTAIAYR---------HTIPLS-HRSSTQQHKQLSLRRGTPYLIX 241 MA A+LH++PS H A++ H IPL+ + ++ LS RR T Sbjct: 1 MACAYAVLHSIPSQHKKLEAFQPFTGLRRGLHGIPLNPFWNIGGRNHMLSGRRATK---- 56 Query: 242 XXXXXLQRRAALPVISAIPVVGPITNFVTNPFVLSFLYLIGAIRFVSGFSKTTFSDTLLV 421 +Q RA LPV+S IPVVGPI NFV +P +L +Y+ GAIRF SGFS+T +SDTL Sbjct: 57 ----RVQTRAGLPVVSNIPVVGPILNFVISPTLLIAIYVFGAIRFQSGFSRTIYSDTLAN 112 Query: 422 RFGLAAIWPVLFVISKRFRENFKK 493 R GL AIWPVLF++SK FRENF++ Sbjct: 113 RVGLTAIWPVLFLLSKAFRENFQR 136 >ref|XP_001756061.1| predicted protein [Physcomitrella patens] gi|162692571|gb|EDQ78927.1| predicted protein [Physcomitrella patens] Length = 151 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/76 (53%), Positives = 54/76 (71%) Frame = +2 Query: 266 RAALPVISAIPVVGPITNFVTNPFVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIW 445 RA LPVIS++PV+GP+ N V NP +L +Y GA RF SGF KTT++D + + A+W Sbjct: 73 RAGLPVISSVPVLGPLANAVFNPVLLFIVYAAGAFRFYSGFKKTTYADNSATKISMTALW 132 Query: 446 PVLFVISKRFRENFKK 493 PVLF+ SK +R NFKK Sbjct: 133 PVLFIASKAYRNNFKK 148 >ref|WP_017656125.1| hypothetical protein [Microchaete sp. PCC 7126] Length = 62 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = +2 Query: 350 LYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKK 493 LY GA +F GF +T FS TL R GL+ +WP LF+I+K +R NF+K Sbjct: 11 LYGYGAWKFWYGFERTNFSQTLPNRIGLSLLWPALFIINKSYRRNFQK 58 >ref|YP_002374128.1| hypothetical protein PCC8801_4033 [Cyanothece sp. PCC 8801] gi|257061815|ref|YP_003139703.1| hypothetical protein Cyan8802_4071 [Cyanothece sp. PCC 8802] gi|501594793|ref|WP_012597226.1| hypothetical protein [Cyanothece] gi|218169235|gb|ACK67972.1| conserved hypothetical protein [Cyanothece sp. PCC 8801] gi|256591981|gb|ACV02868.1| conserved hypothetical protein [Cyanothece sp. PCC 8802] Length = 65 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/54 (40%), Positives = 37/54 (68%) Frame = +2 Query: 332 PFVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKK 493 PF++ +YL G +FV G++ T FS L + L+ +WPVLF+++ +R+NF+K Sbjct: 6 PFIILVIYLAGVWKFVQGYNLTNFSRQLPTKLILSLLWPVLFIVNGSYRQNFQK 59