BLASTX nr result
ID: Ephedra26_contig00002145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00002145 (1614 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006878661.1| hypothetical protein AMTR_s00011p00266440 [A... 64 2e-07 >ref|XP_006878661.1| hypothetical protein AMTR_s00011p00266440 [Amborella trichopoda] gi|548832004|gb|ERM94806.1| hypothetical protein AMTR_s00011p00266440 [Amborella trichopoda] Length = 555 Score = 63.9 bits (154), Expect = 2e-07 Identities = 37/71 (52%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = +2 Query: 1391 RYSRRRGTNEHTDENMNFRRNHSVGRLRDRVLRSMTSSEGPPGNSLEEPLARESRQ-NER 1567 R RR G E + +M F R SVGRLRDRVLR +SSEG GN E+ + R+ RQ N R Sbjct: 267 RPCRRLGALEPVEGSMQFSRTLSVGRLRDRVLRRTSSSEGSLGNLQEDTVFRDMRQSNGR 326 Query: 1568 RIWDTLTGGTS 1600 R W LTG S Sbjct: 327 RFWGALTGSAS 337