BLASTX nr result
ID: Ephedra26_contig00001649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00001649 (562 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA51612.1| TPA: putative cytochrome P450 superfamily protei... 69 6e-10 gb|AFW67510.1| putative cytochrome P450 superfamily protein [Zea... 69 6e-10 ref|XP_002463829.1| hypothetical protein SORBIDRAFT_01g007000 [S... 69 6e-10 gb|ACG40251.1| cytochrome P450 CYP74A18 [Zea mays] gi|414873053|... 69 6e-10 ref|XP_003558850.1| PREDICTED: allene oxide synthase 1, chloropl... 68 1e-09 gb|EMT24584.1| Allene oxide synthase 1, chloroplastic [Aegilops ... 66 5e-09 dbj|BAJ97490.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 9e-09 ref|XP_006375037.1| hypothetical protein POPTR_0014s03820g [Popu... 64 3e-08 gb|EMS48995.1| Allene oxide synthase 1, chloroplastic [Triticum ... 64 3e-08 gb|AFC17171.1| cytochrome P450 allene oxide synthase, partial [P... 64 3e-08 gb|ACZ67201.1| cytochrome P450 allene oxide synthase [Populus de... 64 3e-08 gb|ACZ67200.1| cytochrome P450 allene oxide synthase [Populus ba... 64 3e-08 ref|XP_002326909.1| cytochrome P450 allene oxide synthase [Popul... 64 3e-08 gb|AGP76299.1| allene oxide synthase, partial [Oryza australiensis] 64 3e-08 gb|AGP76298.1| allene oxide synthase, partial [Oryza punctata] 64 3e-08 ref|XP_004499109.1| PREDICTED: allene oxide synthase, chloroplas... 64 3e-08 gb|AED99866.1| cytochrome P450 [Panax notoginseng] 64 3e-08 gb|AGP76294.1| allene oxide synthase, partial [Oryza meridionalis] 63 4e-08 gb|AGP76292.1| allene oxide synthase, partial [Oryza longistamin... 63 4e-08 dbj|BAJ78216.1| allene oxide synthase [Lotus japonicus] 63 4e-08 >tpg|DAA51612.1| TPA: putative cytochrome P450 superfamily protein [Zea mays] Length = 519 Score = 69.3 bits (168), Expect = 6e-10 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV +IA+LLVAELF+RYDSF++QV A ALG+SV TSLKKA Sbjct: 473 AGKDFVVLIARLLVAELFLRYDSFDVQVGASALGSSVTITSLKKA 517 >gb|AFW67510.1| putative cytochrome P450 superfamily protein [Zea mays] Length = 511 Score = 69.3 bits (168), Expect = 6e-10 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV +IA+LLVAELF+RYDSF++QV A ALG+SV TSLKKA Sbjct: 465 AGKDFVVLIARLLVAELFLRYDSFDVQVGASALGSSVTITSLKKA 509 >ref|XP_002463829.1| hypothetical protein SORBIDRAFT_01g007000 [Sorghum bicolor] gi|241917683|gb|EER90827.1| hypothetical protein SORBIDRAFT_01g007000 [Sorghum bicolor] Length = 512 Score = 69.3 bits (168), Expect = 6e-10 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV +IA+LLVAELF+RYDSF++QV A ALG+SV TSLKKA Sbjct: 466 AGKDFVVLIARLLVAELFLRYDSFDVQVGASALGSSVTITSLKKA 510 >gb|ACG40251.1| cytochrome P450 CYP74A18 [Zea mays] gi|414873053|tpg|DAA51610.1| TPA: putative cytochrome P450 superfamily protein [Zea mays] Length = 516 Score = 69.3 bits (168), Expect = 6e-10 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV +IA+LLVAELF+RYDSF++QV A ALG+SV TSLKKA Sbjct: 470 AGKDFVVLIARLLVAELFLRYDSFDVQVGASALGSSVTITSLKKA 514 >ref|XP_003558850.1| PREDICTED: allene oxide synthase 1, chloroplastic-like [Brachypodium distachyon] Length = 511 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV +IA+LLVAELF+RYDSF++QV + ALG+SV TSLKKA Sbjct: 465 AGKDFVVLIARLLVAELFLRYDSFDVQVGSSALGSSVTITSLKKA 509 >gb|EMT24584.1| Allene oxide synthase 1, chloroplastic [Aegilops tauschii] Length = 121 Score = 66.2 bits (160), Expect = 5e-09 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV +IA+LLVAELF+RYDSF++QV + LG+SV TSLKKA Sbjct: 75 AGKDFVVLIARLLVAELFLRYDSFDVQVGSSPLGSSVTITSLKKA 119 >dbj|BAJ97490.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 510 Score = 65.5 bits (158), Expect = 9e-09 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV +IA+LLVAE+F+RYDSF++QV + LG+SV TSLKKA Sbjct: 464 AGKDFVVLIARLLVAEIFLRYDSFDVQVGSSPLGSSVTITSLKKA 508 >ref|XP_006375037.1| hypothetical protein POPTR_0014s03820g [Populus trichocarpa] gi|550323351|gb|ERP52834.1| hypothetical protein POPTR_0014s03820g [Populus trichocarpa] Length = 526 Score = 63.9 bits (154), Expect = 3e-08 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKAK 423 AGKDFV ++A+LLV ELF+RYDSFEI+V +LGA+V TSLK+A+ Sbjct: 480 AGKDFVVLVARLLVVELFLRYDSFEIEVGKSSLGAAVTVTSLKRAR 525 >gb|EMS48995.1| Allene oxide synthase 1, chloroplastic [Triticum urartu] Length = 125 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV +IA+LLVAELF+RYDS ++QV + LG+SV TSLKKA Sbjct: 79 AGKDFVVLIARLLVAELFLRYDSLDVQVGSSPLGSSVTITSLKKA 123 >gb|AFC17171.1| cytochrome P450 allene oxide synthase, partial [Populus laurifolia] Length = 210 Score = 63.9 bits (154), Expect = 3e-08 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKAK 423 AGKDFV ++A+LLV ELF+RYDSFEI+V +LGA+V TSLK+A+ Sbjct: 164 AGKDFVVLVARLLVVELFLRYDSFEIEVGKSSLGAAVTVTSLKRAR 209 >gb|ACZ67201.1| cytochrome P450 allene oxide synthase [Populus deltoides] Length = 227 Score = 63.9 bits (154), Expect = 3e-08 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKAK 423 AGKDFV ++A+LLV ELF+RYDSFEI+V +LGA+V TSLK+A+ Sbjct: 181 AGKDFVVLVARLLVVELFLRYDSFEIEVGKSSLGAAVTVTSLKRAR 226 >gb|ACZ67200.1| cytochrome P450 allene oxide synthase [Populus balsamifera] Length = 227 Score = 63.9 bits (154), Expect = 3e-08 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKAK 423 AGKDFV ++A+LLV ELF+RYDSFEI+V +LGA+V TSLK+A+ Sbjct: 181 AGKDFVVLVARLLVVELFLRYDSFEIEVGKSSLGAAVTVTSLKRAR 226 >ref|XP_002326909.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] Length = 445 Score = 63.9 bits (154), Expect = 3e-08 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKAK 423 AGKDFV ++A+LLV ELF+RYDSFEI+V +LGA+V TSLK+A+ Sbjct: 399 AGKDFVVLVARLLVVELFLRYDSFEIEVGKSSLGAAVTVTSLKRAR 444 >gb|AGP76299.1| allene oxide synthase, partial [Oryza australiensis] Length = 93 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV ++A+LL+ ELF+RYDSF+++V + ALG+SV TSLKKA Sbjct: 47 AGKDFVVLVARLLLVELFLRYDSFDVEVGSSALGSSVTVTSLKKA 91 >gb|AGP76298.1| allene oxide synthase, partial [Oryza punctata] Length = 93 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV ++A+LL+ ELF+RYDSF+++V + ALG+SV TSLKKA Sbjct: 47 AGKDFVVLVARLLLVELFLRYDSFDVEVGSSALGSSVTVTSLKKA 91 >ref|XP_004499109.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cicer arietinum] Length = 523 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV ++++LLV ELF+RYDSFEIQV LGAS+ TSLK++ Sbjct: 477 AGKDFVTLVSRLLVVELFMRYDSFEIQVGTSPLGASITLTSLKRS 521 >gb|AED99866.1| cytochrome P450 [Panax notoginseng] Length = 522 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 40/45 (88%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV ++++LL+ ELF+RYDSFE++V+A +LGASV TSLK+A Sbjct: 476 AGKDFVILMSRLLLVELFLRYDSFEVEVAASSLGASVTITSLKRA 520 >gb|AGP76294.1| allene oxide synthase, partial [Oryza meridionalis] Length = 93 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV ++A+LL+ ELF+RYDSF+++V ALG+SV TSLKKA Sbjct: 47 AGKDFVVLVARLLLVELFLRYDSFDVEVGTSALGSSVTVTSLKKA 91 >gb|AGP76292.1| allene oxide synthase, partial [Oryza longistaminata] Length = 93 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV ++A+LL+ ELF+RYDSF+++V ALG+SV TSLKKA Sbjct: 47 AGKDFVVLVARLLLVELFLRYDSFDVEVGTSALGSSVTVTSLKKA 91 >dbj|BAJ78216.1| allene oxide synthase [Lotus japonicus] Length = 528 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 560 AGKDFVNMIAKLLVAELFIRYDSFEIQVSAGALGASVCFTSLKKA 426 AGKDFV ++++LLV ELF+RYDSFEIQV LG++V TSLK+A Sbjct: 482 AGKDFVTLVSRLLVVELFLRYDSFEIQVGTSPLGSAVTLTSLKRA 526