BLASTX nr result
ID: Ephedra26_contig00001147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00001147 (501 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24608.1| unknown [Picea sitchensis] 70 2e-10 ref|XP_006488736.1| PREDICTED: rRNA-processing protein fcf2-like... 56 4e-06 ref|XP_006419236.1| hypothetical protein CICLE_v10005920mg [Citr... 56 4e-06 ref|XP_004140538.1| PREDICTED: rRNA-processing protein fcf2-like... 56 6e-06 ref|XP_002519321.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >gb|ABK24608.1| unknown [Picea sitchensis] Length = 347 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/46 (80%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -1 Query: 501 EFYS-RLTKKERKPTIADELLSDRDFNQYRKRKHLEIEKQYNPPRK 367 EFYS RLTKKERKPTIADELLSD F QYRKRKHLEIE+ NP K Sbjct: 288 EFYSGRLTKKERKPTIADELLSDSAFQQYRKRKHLEIERVNNPVGK 333 >ref|XP_006488736.1| PREDICTED: rRNA-processing protein fcf2-like [Citrus sinensis] Length = 202 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -1 Query: 498 FYSRLTKKERKPTIADELLSDRDFNQYRKRKHLEIEKQYNP 376 F SRLTKKERK T+ADELLSD QYRKRK EIE Q P Sbjct: 140 FSSRLTKKERKATLADELLSDPTLGQYRKRKVREIESQNRP 180 >ref|XP_006419236.1| hypothetical protein CICLE_v10005920mg [Citrus clementina] gi|557521109|gb|ESR32476.1| hypothetical protein CICLE_v10005920mg [Citrus clementina] Length = 202 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -1 Query: 498 FYSRLTKKERKPTIADELLSDRDFNQYRKRKHLEIEKQYNP 376 F SRLTKKERK T+ADELLSD QYRKRK EIE Q P Sbjct: 140 FSSRLTKKERKATLADELLSDPTLGQYRKRKVREIESQNRP 180 >ref|XP_004140538.1| PREDICTED: rRNA-processing protein fcf2-like [Cucumis sativus] gi|449523942|ref|XP_004168982.1| PREDICTED: rRNA-processing protein fcf2-like [Cucumis sativus] Length = 197 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -1 Query: 498 FYSRLTKKERKPTIADELLSDRDFNQYRKRKHLEIEKQYNP 376 F RLTKKERK T+ADELLSD+ QYRKRK EIE+Q P Sbjct: 135 FSGRLTKKERKATLADELLSDQALTQYRKRKVREIEEQNRP 175 >ref|XP_002519321.1| conserved hypothetical protein [Ricinus communis] gi|223541636|gb|EEF43185.1| conserved hypothetical protein [Ricinus communis] Length = 200 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 498 FYSRLTKKERKPTIADELLSDRDFNQYRKRKHLEIEKQYNPPRKSRF 358 F RLTKKERKPT+A+E+LSDR YRKRK EIE+Q P R+ Sbjct: 138 FSGRLTKKERKPTLAEEILSDRTLAAYRKRKVREIEEQDGPGGNERW 184