BLASTX nr result
ID: Ephedra26_contig00000722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00000722 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002460801.1| hypothetical protein SORBIDRAFT_02g035160 [S... 56 4e-06 >ref|XP_002460801.1| hypothetical protein SORBIDRAFT_02g035160 [Sorghum bicolor] gi|241924178|gb|EER97322.1| hypothetical protein SORBIDRAFT_02g035160 [Sorghum bicolor] Length = 318 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/46 (52%), Positives = 29/46 (63%) Frame = +1 Query: 1 GLVKTDWSKAPFVASYRVFRLVPCYSPRAAPHAPCSVSTADKWWNQ 138 GL KTDWS+APFV+SYR F C P A C+ +T D WW+Q Sbjct: 222 GLEKTDWSRAPFVSSYRDFAADACAWPAAGGPPACAAATGDSWWDQ 267