BLASTX nr result
ID: Ephedra26_contig00000368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00000368 (541 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24824.1| unknown [Picea sitchensis] 89 6e-16 ref|XP_006856145.1| hypothetical protein AMTR_s00059p00166490 [A... 79 9e-13 ref|XP_006479363.1| PREDICTED: protein TIC 62, chloroplastic-lik... 78 1e-12 ref|XP_006470896.1| PREDICTED: protein TIC 62, chloroplastic-lik... 78 1e-12 ref|XP_006423140.1| hypothetical protein CICLE_v10028081mg [Citr... 78 1e-12 ref|XP_004507400.1| PREDICTED: protein TIC 62, chloroplastic-lik... 74 2e-11 ref|XP_004289691.1| PREDICTED: protein TIC 62, chloroplastic-lik... 74 2e-11 ref|XP_006406552.1| hypothetical protein EUTSA_v10020309mg [Eutr... 74 3e-11 ref|NP_188519.2| protein TIC 62 [Arabidopsis thaliana] gi|751518... 74 3e-11 dbj|BAB03098.1| unnamed protein product [Arabidopsis thaliana] 74 3e-11 gb|ABV89636.1| catalytic/coenzyme binding protein [Brassica rapa] 74 3e-11 gb|EXB41556.1| hypothetical protein L484_013631 [Morus notabilis] 72 6e-11 ref|XP_006297181.1| hypothetical protein CARUB_v10013185mg [Caps... 72 6e-11 ref|XP_006592114.1| PREDICTED: protein TIC 62, chloroplastic-lik... 72 1e-10 ref|XP_003541088.1| PREDICTED: protein TIC 62, chloroplastic-lik... 72 1e-10 ref|XP_003576689.1| PREDICTED: uncharacterized protein LOC100834... 71 1e-10 gb|EMJ02332.1| hypothetical protein PRUPE_ppa017158mg [Prunus pe... 70 2e-10 ref|XP_002883157.1| catalytic/ coenzyme binding protein [Arabido... 70 2e-10 ref|XP_002313068.2| Tic62 family protein [Populus trichocarpa] g... 70 3e-10 ref|XP_006349647.1| PREDICTED: protein TIC 62, chloroplastic-lik... 69 5e-10 >gb|ABK24824.1| unknown [Picea sitchensis] Length = 382 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = +3 Query: 3 ADTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 ADTYFGGQVSNLQVAEL+ACMTK R+ S NKV+EVIAETTAP LP+EELLA L Sbjct: 249 ADTYFGGQVSNLQVAELIACMTKNRELSMNKVIEVIAETTAPLLPMEELLASL 301 >ref|XP_006856145.1| hypothetical protein AMTR_s00059p00166490 [Amborella trichopoda] gi|548860004|gb|ERN17612.1| hypothetical protein AMTR_s00059p00166490 [Amborella trichopoda] Length = 452 Score = 78.6 bits (192), Expect = 9e-13 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DTYFGGQVSNLQVAEL+A M K RD S NKVVEVIAETTAP LP+ ELL+K+ Sbjct: 277 DTYFGGQVSNLQVAELMAFMGKNRDLSCNKVVEVIAETTAPLLPMGELLSKV 328 >ref|XP_006479363.1| PREDICTED: protein TIC 62, chloroplastic-like isoform X1 [Citrus sinensis] gi|568851366|ref|XP_006479364.1| PREDICTED: protein TIC 62, chloroplastic-like isoform X2 [Citrus sinensis] Length = 530 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/52 (78%), Positives = 43/52 (82%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K R S KVVEVIAETTAP P+EELLAK+ Sbjct: 276 DTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKI 327 >ref|XP_006470896.1| PREDICTED: protein TIC 62, chloroplastic-like [Citrus sinensis] Length = 368 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/52 (78%), Positives = 43/52 (82%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K R S KVVEVIAETTAP P+EELLAK+ Sbjct: 276 DTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKI 327 >ref|XP_006423140.1| hypothetical protein CICLE_v10028081mg [Citrus clementina] gi|557525074|gb|ESR36380.1| hypothetical protein CICLE_v10028081mg [Citrus clementina] Length = 585 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/52 (78%), Positives = 43/52 (82%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K R S KVVEVIAETTAP P+EELLAK+ Sbjct: 331 DTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKI 382 >ref|XP_004507400.1| PREDICTED: protein TIC 62, chloroplastic-like [Cicer arietinum] Length = 583 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAE +A M K RD S KVVEVIAETTAP P+EELLAK+ Sbjct: 275 DTLFGGQVSNLQVAEFMAVMAKNRDLSYCKVVEVIAETTAPLKPMEELLAKI 326 >ref|XP_004289691.1| PREDICTED: protein TIC 62, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 616 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAEL+AC+ K R S KVVEV+AETT P P+EELLAK+ Sbjct: 275 DTLFGGQVSNLQVAELMACIAKNRGLSYCKVVEVVAETTVPLTPLEELLAKI 326 >ref|XP_006406552.1| hypothetical protein EUTSA_v10020309mg [Eutrema salsugineum] gi|557107698|gb|ESQ48005.1| hypothetical protein EUTSA_v10020309mg [Eutrema salsugineum] Length = 619 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K S +K+VEV+AETTAP PIE+LL K+ Sbjct: 274 DTLFGGQVSNLQVAELLACMAKNPQLSFSKIVEVVAETTAPLTPIEKLLEKI 325 >ref|NP_188519.2| protein TIC 62 [Arabidopsis thaliana] gi|75151827|sp|Q8H0U5.1|TIC62_ARATH RecName: Full=Protein TIC 62, chloroplastic; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 62; Short=AtTIC62; Flags: Precursor gi|25083201|gb|AAN72050.1| Unknown protein [Arabidopsis thaliana] gi|30725480|gb|AAP37762.1| At3g18890 [Arabidopsis thaliana] gi|332642643|gb|AEE76164.1| protein TIC 62 [Arabidopsis thaliana] Length = 641 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K S +K+VEV+AETTAP PIE+LL K+ Sbjct: 275 DTLFGGQVSNLQVAELLACMAKNPQLSFSKIVEVVAETTAPLTPIEKLLEKI 326 >dbj|BAB03098.1| unnamed protein product [Arabidopsis thaliana] Length = 649 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K S +K+VEV+AETTAP PIE+LL K+ Sbjct: 283 DTLFGGQVSNLQVAELLACMAKNPQLSFSKIVEVVAETTAPLTPIEKLLEKI 334 >gb|ABV89636.1| catalytic/coenzyme binding protein [Brassica rapa] Length = 624 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K S +K+VEV+AETTAP PIE+LL K+ Sbjct: 274 DTLFGGQVSNLQVAELLACMAKNPQLSCSKIVEVVAETTAPLTPIEKLLKKI 325 >gb|EXB41556.1| hypothetical protein L484_013631 [Morus notabilis] Length = 503 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGG VSNLQVAEL+AC+ K RD S KVVEVIA+TTAP P+EELL K+ Sbjct: 278 DTLFGGLVSNLQVAELMACIAKNRDLSYCKVVEVIAQTTAPLTPMEELLKKI 329 >ref|XP_006297181.1| hypothetical protein CARUB_v10013185mg [Capsella rubella] gi|482565890|gb|EOA30079.1| hypothetical protein CARUB_v10013185mg [Capsella rubella] Length = 643 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K S +K+VEV+AETTAP P+E+LL K+ Sbjct: 277 DTLFGGQVSNLQVAELLACMAKNPQLSCSKIVEVVAETTAPLTPMEKLLEKI 328 >ref|XP_006592114.1| PREDICTED: protein TIC 62, chloroplastic-like isoform X3 [Glycine max] Length = 526 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGG VSNLQ+AELLA M K RD S K+VE IAETTAP P+EELLAK+ Sbjct: 274 DTLFGGLVSNLQIAELLAVMAKNRDLSYCKIVEAIAETTAPLTPMEELLAKI 325 >ref|XP_003541088.1| PREDICTED: protein TIC 62, chloroplastic-like isoform X1 [Glycine max] gi|571492051|ref|XP_006592113.1| PREDICTED: protein TIC 62, chloroplastic-like isoform X2 [Glycine max] Length = 528 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGG VSNLQ+AELLA M K RD S K+VE IAETTAP P+EELLAK+ Sbjct: 276 DTLFGGLVSNLQIAELLAVMAKNRDLSYCKIVEAIAETTAPLTPMEELLAKI 327 >ref|XP_003576689.1| PREDICTED: uncharacterized protein LOC100834133 [Brachypodium distachyon] Length = 475 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DTY GGQVSNLQVAEL+AC+ K R + KVVEVIAETTAP LP+E++LA + Sbjct: 271 DTYSGGQVSNLQVAELIACIAKNRAAAYCKVVEVIAETTAPLLPMEDILASV 322 >gb|EMJ02332.1| hypothetical protein PRUPE_ppa017158mg [Prunus persica] Length = 570 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLA K R S KVVEVIAETTAP P+E+LLAK+ Sbjct: 271 DTLFGGQVSNLQVAELLASAAKNRAVSYFKVVEVIAETTAPLTPLEDLLAKI 322 >ref|XP_002883157.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. lyrata] gi|297328997|gb|EFH59416.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. lyrata] Length = 668 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAELLACM K S +K+VEV+AETTAP IE+LL K+ Sbjct: 275 DTLFGGQVSNLQVAELLACMAKNPQLSFSKIVEVVAETTAPLTSIEKLLEKI 326 >ref|XP_002313068.2| Tic62 family protein [Populus trichocarpa] gi|550331519|gb|EEE87023.2| Tic62 family protein [Populus trichocarpa] Length = 573 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGGQVSNLQVAE +A M K R S KVVEVIAETTAP P++ELLAK+ Sbjct: 272 DTLFGGQVSNLQVAEFMAFMAKNRGLSYCKVVEVIAETTAPLTPMDELLAKI 323 >ref|XP_006349647.1| PREDICTED: protein TIC 62, chloroplastic-like [Solanum tuberosum] Length = 740 Score = 69.3 bits (168), Expect = 5e-10 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = +3 Query: 6 DTYFGGQVSNLQVAELLACMTKYRDYSKNKVVEVIAETTAPRLPIEELLAKL 161 DT FGG VSNLQVAEL+A M K R S KVVEV+AETTAP P+E+LLAK+ Sbjct: 268 DTLFGGLVSNLQVAELMAVMAKNRSLSYCKVVEVVAETTAPLTPMEDLLAKI 319