BLASTX nr result
ID: Ephedra26_contig00000237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00000237 (785 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002960780.1| hypothetical protein SELMODRAFT_75361 [Selag... 60 7e-07 >ref|XP_002960780.1| hypothetical protein SELMODRAFT_75361 [Selaginella moellendorffii] gi|300171719|gb|EFJ38319.1| hypothetical protein SELMODRAFT_75361 [Selaginella moellendorffii] Length = 186 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 785 LATSLLWKGFTWPLAAVNEFRSGDLVEKEENITVSPR 675 LATSL+WKGF WPLAAV+EFR+G LV NITVSPR Sbjct: 150 LATSLIWKGFVWPLAAVSEFRNGKLVVDAGNITVSPR 186