BLASTX nr result
ID: Ephedra25_contig00029164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00029164 (542 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004506986.1| PREDICTED: auxin-induced protein 15A-like [C... 56 6e-06 gb|AFW85468.1| hypothetical protein ZEAMMB73_180738 [Zea mays] 56 6e-06 gb|ESW03720.1| hypothetical protein PHAVU_011G036600g [Phaseolus... 55 8e-06 ref|XP_003534342.1| PREDICTED: indole-3-acetic acid-induced prot... 55 8e-06 ref|NP_001237107.1| uncharacterized protein LOC100500377 [Glycin... 55 8e-06 >ref|XP_004506986.1| PREDICTED: auxin-induced protein 15A-like [Cicer arietinum] Length = 100 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -2 Query: 388 GKTHKKFVIPMKYLSRPLFSWLLEEAEQEFEFNYSNGLIMIPC 260 GK +K+FVIP+ YLS PLF LL+ AEQEF FN+ G + IPC Sbjct: 45 GKDYKRFVIPISYLSHPLFKDLLDWAEQEFGFNHPMGGLTIPC 87 >gb|AFW85468.1| hypothetical protein ZEAMMB73_180738 [Zea mays] Length = 236 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = -2 Query: 388 GKTHKKFVIPMKYLSRPLFSWLLEEAEQEFEFNYSNGLIMIPCD 257 G ++FV+P YL P+F LLE+AE+EFEF+Y G + IPCD Sbjct: 158 GAERRRFVVPTAYLGMPVFRRLLEKAEEEFEFDYHGGAVTIPCD 201 >gb|ESW03720.1| hypothetical protein PHAVU_011G036600g [Phaseolus vulgaris] Length = 145 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -2 Query: 388 GKTHKKFVIPMKYLSRPLFSWLLEEAEQEFEFNYSNGLIMIPC 260 G+ HK+FVIP+ YLS PLF LL+ AE+EF FN+ G + IPC Sbjct: 90 GENHKRFVIPISYLSHPLFRDLLDWAEEEFGFNHPMGGLTIPC 132 >ref|XP_003534342.1| PREDICTED: indole-3-acetic acid-induced protein ARG7 [Glycine max] Length = 99 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -2 Query: 388 GKTHKKFVIPMKYLSRPLFSWLLEEAEQEFEFNYSNGLIMIPC 260 G+ HK+FVIP+ YLS PLF LL+ AE+EF FN+ G + IPC Sbjct: 44 GENHKRFVIPISYLSHPLFRDLLDWAEEEFGFNHPMGGLTIPC 86 >ref|NP_001237107.1| uncharacterized protein LOC100500377 [Glycine max] gi|255630163|gb|ACU15435.1| unknown [Glycine max] Length = 99 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -2 Query: 388 GKTHKKFVIPMKYLSRPLFSWLLEEAEQEFEFNYSNGLIMIPC 260 G+ HK+FVIP+ YLS PLF LL+ AE+EF FN+ G + IPC Sbjct: 44 GENHKRFVIPISYLSHPLFRDLLDWAEEEFGFNHPMGGLTIPC 86