BLASTX nr result
ID: Ephedra25_contig00028531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00028531 (458 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004308608.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 ref|XP_006651327.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 gb|EMJ15377.1| hypothetical protein PRUPE_ppa019185mg [Prunus pe... 74 2e-11 gb|EXB95839.1| hypothetical protein L484_010038 [Morus notabilis] 74 3e-11 gb|EOY28177.1| Tetratricopeptide repeat-like superfamily protein... 74 3e-11 gb|EMT27537.1| Pentatricopeptide repeat-containing protein [Aegi... 73 3e-11 gb|EMS46161.1| hypothetical protein TRIUR3_10442 [Triticum urartu] 73 3e-11 ref|XP_003541343.1| PREDICTED: putative pentatricopeptide repeat... 73 3e-11 gb|EXB70668.1| hypothetical protein L484_023854 [Morus notabilis] 73 5e-11 ref|XP_004972232.1| PREDICTED: putative pentatricopeptide repeat... 73 5e-11 ref|XP_004229452.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_006658876.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_004952954.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_006602194.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_002516788.1| pentatricopeptide repeat-containing protein,... 72 6e-11 gb|EPS69104.1| hypothetical protein M569_05662, partial [Genlise... 72 8e-11 emb|CAJ32535.1| pentatricopeptide repeat-containing protein [Hor... 72 8e-11 ref|NP_001172331.1| Os01g0355000 [Oryza sativa Japonica Group] g... 72 8e-11 gb|AFW62799.1| putative pentatricopeptide repeat family protein ... 72 8e-11 dbj|BAK04789.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 8e-11 >ref|XP_004308608.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Fragaria vesca subsp. vesca] Length = 861 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/50 (64%), Positives = 42/50 (84%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CM+D+L RAGKI+EA E++NTMPF+A+A WGSLLGA R H+N E+G+ Sbjct: 629 YACMIDILGRAGKIQEAMELVNTMPFQANASVWGSLLGAARIHKNVELGE 678 >ref|XP_006651327.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Oryza brachyantha] Length = 733 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGKC*RNQM 289 Y CMVDLL RAG +EEA ++IN MP E DA+ WG+L+GACR HRN E+ + N++ Sbjct: 500 YSCMVDLLGRAGLVEEALDLINNMPVEPDAVIWGALMGACRMHRNAEIAELAANKL 555 >gb|EMJ15377.1| hypothetical protein PRUPE_ppa019185mg [Prunus persica] Length = 858 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CM+DLL RAGKI EA E++NTMPF+A+A WG+LLGA R H+N E+G+ Sbjct: 626 YACMIDLLGRAGKINEAMELVNTMPFQANASVWGALLGAARIHKNVELGQ 675 >gb|EXB95839.1| hypothetical protein L484_010038 [Morus notabilis] Length = 709 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 YGCMVDLL RAG++EEA E+I +MP +AD + WG+LL ACR H N E+G+ Sbjct: 605 YGCMVDLLGRAGRLEEAEELIKSMPMKADIVIWGTLLAACRTHGNVEVGE 654 >gb|EOY28177.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 946 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CM+DLL RAG+++EA E+ NTMPF+ADA WG+LLGA R H+N E+G+ Sbjct: 714 YACMIDLLGRAGRLDEAMELANTMPFQADASVWGALLGAARIHKNVELGQ 763 >gb|EMT27537.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii] Length = 444 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 YGCMVDLL RAG +EEA ++I +MPFE DAI W +LLGACR H+N E+ + Sbjct: 212 YGCMVDLLGRAGHVEEAMQLIRSMPFEPDAIIWRTLLGACRIHKNVEIAE 261 >gb|EMS46161.1| hypothetical protein TRIUR3_10442 [Triticum urartu] Length = 492 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 YGCMVDLL RAG +EEA ++I +MPFE DAI W +LLGACR H+N E+ + Sbjct: 260 YGCMVDLLGRAGHVEEAMQLIRSMPFEPDAIIWRTLLGACRIHKNVEIAE 309 >ref|XP_003541343.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like isoform X1 [Glycine max] gi|571497773|ref|XP_006594017.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like isoform X2 [Glycine max] Length = 747 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CM+DL +RAG++EEAR+ IN MPF DAI W SLL +CR HRN E+GK Sbjct: 515 YTCMIDLFSRAGRLEEARKFINKMPFSPDAIGWASLLSSCRFHRNMEIGK 564 >gb|EXB70668.1| hypothetical protein L484_023854 [Morus notabilis] Length = 628 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 YGCMVDLL RAG IEEA E+I++MP E DA WG+LLGACR H E+G+ Sbjct: 481 YGCMVDLLGRAGLIEEAEELISSMPMEPDAYIWGALLGACRIHGEVELGE 530 >ref|XP_004972232.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Setaria italica] Length = 640 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CMVDLL RAG++EEARE+I++MP AD WG+LLGAC+ H+N E+G+ Sbjct: 408 YTCMVDLLGRAGRLEEARELISSMPMPADGAVWGALLGACKIHKNAEVGE 457 >ref|XP_004229452.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial-like [Solanum lycopersicum] Length = 700 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 YGCMVDL RAG+++EA E+I +MP EAD I WG+LL ACR H N E+G+ Sbjct: 596 YGCMVDLFGRAGRLKEAEELIRSMPMEADIIIWGTLLAACRTHGNTEIGE 645 >ref|XP_006658876.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Oryza brachyantha] Length = 509 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 YGCMVDLL R+G +EEAR +I +MPFE DAI W +LLGACR H+N ++ + Sbjct: 277 YGCMVDLLGRSGHVEEARHLIRSMPFEPDAIIWRALLGACRIHKNVDIAE 326 >ref|XP_004952954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Setaria italica] Length = 883 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/50 (60%), Positives = 41/50 (82%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CM+DLL RAGK+E+A E++N MPFEA+A WG+LLGA R H++ E+G+ Sbjct: 651 YSCMIDLLGRAGKLEDAMELVNNMPFEANAAVWGALLGASRVHQDPELGR 700 >ref|XP_006602194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like isoform X1 [Glycine max] Length = 775 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 YGCMVDLL RAG ++EA E+I++MP D WG+LLGACR HR++EMG+ Sbjct: 543 YGCMVDLLGRAGLLKEAEELIDSMPMAPDVATWGALLGACRKHRDNEMGE 592 >ref|XP_002516788.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543876|gb|EEF45402.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 710 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 YGCMVDLL RAG++EEA E+I +MP +AD + WG+LL ACR H N ++G+ Sbjct: 604 YGCMVDLLGRAGRLEEAEEMIRSMPMKADVVIWGTLLAACRTHGNVDVGE 653 >gb|EPS69104.1| hypothetical protein M569_05662, partial [Genlisea aurea] Length = 775 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y C+VDLL RAG + EA + IN MP EADAI WGSL+GACR H N +MG+ Sbjct: 470 YACLVDLLGRAGLLNEALQTINGMPVEADAIVWGSLMGACRSHVNSDMGE 519 >emb|CAJ32535.1| pentatricopeptide repeat-containing protein [Hordeum vulgare subsp. vulgare] Length = 652 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CMVDLL RAG++EEARE+I++MP AD WG+LLGAC+ H+N E G+ Sbjct: 416 YACMVDLLGRAGRLEEARELISSMPMPADGSVWGALLGACKIHKNVEAGE 465 >ref|NP_001172331.1| Os01g0355000 [Oryza sativa Japonica Group] gi|53791352|dbj|BAD52598.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|215768699|dbj|BAH00928.1| unnamed protein product [Oryza sativa Japonica Group] gi|255673214|dbj|BAH91061.1| Os01g0355000 [Oryza sativa Japonica Group] Length = 877 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CM+DLL RAGK+++A E++N+MPF+A+A WG+LLGA R H++ E+GK Sbjct: 645 YSCMIDLLGRAGKLDDAMELVNSMPFQANASIWGALLGASRVHKDPELGK 694 >gb|AFW62799.1| putative pentatricopeptide repeat family protein [Zea mays] Length = 882 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/50 (58%), Positives = 41/50 (82%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CM+D+L RAGK+E+A E++N MPF+A+A WG+LLGA R HR+ E+G+ Sbjct: 650 YACMIDILGRAGKLEDAMELVNNMPFQANAAVWGALLGASRVHRDPELGR 699 >dbj|BAK04789.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 879 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/50 (60%), Positives = 41/50 (82%) Frame = -3 Query: 456 YGCMVDLLARAGKIEEAREIINTMPFEADAIFWGSLLGACRGHRNHEMGK 307 Y CM+DLL RAGK+++A E++N+MPFEA+A WG+LL A R HR+ E+GK Sbjct: 647 YSCMIDLLGRAGKLDDAMELVNSMPFEANAAVWGALLAASRVHRDPELGK 696