BLASTX nr result
ID: Ephedra25_contig00028260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00028260 (455 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB63463.1| hypothetical protein L484_005426 [Morus notabilis] 58 2e-06 >gb|EXB63463.1| hypothetical protein L484_005426 [Morus notabilis] Length = 355 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = +2 Query: 281 ITGTPTPATKNXXXXXXXXXXYYPDCRKNAQCDCKMCIASIHATLDLRPSNSL 439 + T TPAT+ YYP CRK+A C+CK+C+ASI+ATLDL P +SL Sbjct: 12 VKSTATPATEEEHSC------YYPGCRKDANCNCKICLASINATLDLMPKSSL 58