BLASTX nr result
ID: Ephedra25_contig00027112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00027112 (494 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 62 6e-08 ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 ref|XP_006422433.1| hypothetical protein CICLE_v10027787mg [Citr... 55 7e-06 gb|EOX97442.1| Pentatricopeptide repeat (PPR) superfamily protei... 55 7e-06 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 62.4 bits (150), Expect = 6e-08 Identities = 43/140 (30%), Positives = 72/140 (51%), Gaps = 3/140 (2%) Frame = -1 Query: 413 VSEVLQRNRDHALLAWNFYNWVNHLEITGKDLVV-FKDVSSILCNAKLIEELKHLHQSLA 237 +++ L N + LAW+ + + L I+ +S IL +K+ EL LHQ L Sbjct: 7 LTKALLNNAHNPKLAWHLFKRILSLPISSNHRSQSIPIISRILIRSKMFNELDDLHQLLL 66 Query: 236 KSENRESSSAPKLAILAESLANAGFVHEAFAAYSDLKQFDAKLTPSFY--NALMEASIGK 63 S + ESS + L L LA +GF ++A + + L+ + PS Y N L+++ I + Sbjct: 67 NSPSLESSDS-SLENLVTVLAKSGFFNKAISHFKSLRSNFPEKQPSIYLYNVLLKSCIRE 125 Query: 62 GKMELIPILYKEMIRIIVKP 3 ++EL+ LYK+M+ V P Sbjct: 126 NRVELVSWLYKDMVLARVSP 145 >ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] gi|568866524|ref|XP_006486605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] Length = 889 Score = 55.5 bits (132), Expect = 7e-06 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 3/144 (2%) Frame = -1 Query: 425 TPAIVSEVLQRNRDHALLAWNFYNWVN-HLEITGKDLVVFKDVSSILCNAKLIEELKHLH 249 T +++ L +N ++ LAW + V + T L ++ IL +K++EE+ LH Sbjct: 7 TQVTITKALLKNANNPKLAWQIFRRVILNSPTTNPPLDSVPTIARILIRSKMLEEIHTLH 66 Query: 248 QSLAKSENRESSSAPKLAILAESLANAGFVHEAFAAYSDLKQFDAKLTPSFY--NALMEA 75 L + R +S + L L + LA +G + EAF+ + ++ P Y N L E Sbjct: 67 SLLLSLKPRGNSHS-SLTSLVKILAKSGLLDEAFSQFKSIRVHFHGDPPCIYLYNVLFEC 125 Query: 74 SIGKGKMELIPILYKEMIRIIVKP 3 + K M+ + LYK+M+ V P Sbjct: 126 CVRKQHMDYLMWLYKDMVVAKVSP 149 >ref|XP_006422433.1| hypothetical protein CICLE_v10027787mg [Citrus clementina] gi|557524367|gb|ESR35673.1| hypothetical protein CICLE_v10027787mg [Citrus clementina] Length = 889 Score = 55.5 bits (132), Expect = 7e-06 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 3/144 (2%) Frame = -1 Query: 425 TPAIVSEVLQRNRDHALLAWNFYNWVN-HLEITGKDLVVFKDVSSILCNAKLIEELKHLH 249 T +++ L +N ++ LAW + V + T L ++ IL +K++EE+ LH Sbjct: 7 TQVTITKALLKNANNPKLAWQIFRRVILNSPTTNPPLDSVPTIARILIRSKMLEEIHTLH 66 Query: 248 QSLAKSENRESSSAPKLAILAESLANAGFVHEAFAAYSDLKQFDAKLTPSFY--NALMEA 75 L + R +S + L L + LA +G + EAF+ + ++ P Y N L E Sbjct: 67 SLLLSLKPRGNSHS-SLTSLVKILAKSGLLDEAFSQFKSIRVHFHGDPPCIYLYNVLFEC 125 Query: 74 SIGKGKMELIPILYKEMIRIIVKP 3 + K M+ + LYK+M+ V P Sbjct: 126 CVRKQHMDYLMWLYKDMVVAKVSP 149 >gb|EOX97442.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 872 Score = 55.5 bits (132), Expect = 7e-06 Identities = 37/135 (27%), Positives = 62/135 (45%), Gaps = 2/135 (1%) Frame = -1 Query: 401 LQRNRDHALLAWNFYNWVNHLEITGKDLVVFKDVSSILCNAKLIEELKHLHQSLAKSENR 222 L +N + LAW + + L L +S IL + +++E+ HLH L S+ Sbjct: 10 LLKNTKNPKLAWQLFKRIQSLPTDSSFLPSVPTISRILIRSNMLQEIDHLHHLLLSSQ-P 68 Query: 221 ESSSAPKLAILAESLANAGFVHEAFAAYSDLKQFDAKLTPS--FYNALMEASIGKGKMEL 48 + + L L + LA +GF AF+ + ++ + PS YN L E I + + Sbjct: 69 QLNPLSSLISLVKLLARSGFFDRAFSQFQSIRTKFPQNPPSICLYNVLFECCIKERCSDY 128 Query: 47 IPILYKEMIRIIVKP 3 + LYK+M+ V P Sbjct: 129 VLWLYKDMVGAGVSP 143