BLASTX nr result
ID: Ephedra25_contig00027043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00027043 (430 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q5I2B2.1|AMP_AMARE RecName: Full=Antimicrobial peptide Ar-AMP... 79 8e-13 gb|ABK58702.1| anti-microbial protein 2 [Amaranthus caudatus] gi... 75 9e-12 gb|ABK58701.1| anti-microbial protein 2 [Amaranthus albus] gi|11... 75 9e-12 sp|P27275.2|AMP_AMACA RecName: Full=Antimicrobial peptide 2; Sho... 74 2e-11 emb|CBJ21249.1| AMP-2 precursor [Stellaria media] 64 3e-08 gb|AAB22103.1| Ac-AMP1=antimicrobial peptide [Amaranthus caudatu... 59 5e-07 pdb|1MMC|A Chain A, 1h Nmr Study Of The Solution Structure Of Ac... 59 5e-07 pdb|1ZUV|A Chain A, 24 Nmr Structures Of Acamp2-Like Peptide Wit... 59 7e-07 pdb|1ZWU|A Chain A, 30 Nmr Structures Of Acamp2-Like Peptide Wit... 58 1e-06 gb|EMT18720.1| Endochitinase PR4 [Aegilops tauschii] 55 9e-06 gb|EKD15207.1| AMP-1 precursor [Marssonina brunnea f. sp. 'multi... 55 9e-06 >sp|Q5I2B2.1|AMP_AMARE RecName: Full=Antimicrobial peptide Ar-AMP; Flags: Precursor gi|57791763|gb|AAW56634.1| antimicrobial peptide [Amaranthus retroflexus] Length = 89 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/92 (45%), Positives = 52/92 (56%), Gaps = 8/92 (8%) Frame = +3 Query: 66 MMSMKR-CLIXXXXXXXXXXEPSMGAGECKHGKCPGGLCCSQYGYCGSGPAYCGGV---- 230 M++MK LI +PSMGAGEC G+CP G+CCSQ+GYCG GP YCG Sbjct: 1 MVNMKSVALIVIVMMAFMMVDPSMGAGECVQGRCPSGMCCSQFGYCGRGPKYCGRASTTV 60 Query: 231 ---AEQRAALIQRTGSIPDGAKAAQVHGAGAP 317 A+ AA +T + P AK A GAG+P Sbjct: 61 DHQADAAAAAATKTANNPTDAKLA---GAGSP 89 >gb|ABK58702.1| anti-microbial protein 2 [Amaranthus caudatus] gi|117956274|gb|ABK58705.1| anti-microbial protein 2 [Amaranthus hybridus] Length = 86 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/89 (44%), Positives = 48/89 (53%), Gaps = 5/89 (5%) Frame = +3 Query: 66 MMSMKR-CLIXXXXXXXXXXEPSMGAGECKHGKCPGGLCCSQYGYCGSGPAYCG----GV 230 M++MK LI +PSMG GEC G+CP G+CCSQ+GYCG GP YCG V Sbjct: 1 MVNMKSVALIVIVMMAFMMVDPSMGVGECVRGRCPSGMCCSQFGYCGKGPKYCGRASTTV 60 Query: 231 AEQRAALIQRTGSIPDGAKAAQVHGAGAP 317 Q +T P AK A GAG+P Sbjct: 61 DHQADVAATKTAKNPTDAKLA---GAGSP 86 >gb|ABK58701.1| anti-microbial protein 2 [Amaranthus albus] gi|117956270|gb|ABK58703.1| anti-microbial protein 2 [Amaranthus cruentus] gi|117956272|gb|ABK58704.1| anti-microbial protein 2 [Amaranthus blitum] gi|117956276|gb|ABK58706.1| anti-microbial protein 2 [Amaranthus hypochondriacus] gi|117956278|gb|ABK58707.1| anti-microbial protein 2 [Amaranthus retroflexus] gi|117956280|gb|ABK58708.1| anti-microbial protein 2 [Amaranthus tricolor] Length = 86 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/89 (44%), Positives = 48/89 (53%), Gaps = 5/89 (5%) Frame = +3 Query: 66 MMSMKR-CLIXXXXXXXXXXEPSMGAGECKHGKCPGGLCCSQYGYCGSGPAYCG----GV 230 M++MK LI +PSMG GEC G+CP G+CCSQ+GYCG GP YCG V Sbjct: 1 MVNMKSVALIVIVMMAFMMVDPSMGVGECVRGRCPSGMCCSQFGYCGKGPKYCGRASTTV 60 Query: 231 AEQRAALIQRTGSIPDGAKAAQVHGAGAP 317 Q +T P AK A GAG+P Sbjct: 61 DHQADVAATKTAQNPTDAKLA---GAGSP 86 >sp|P27275.2|AMP_AMACA RecName: Full=Antimicrobial peptide 2; Short=AMP2; Contains: RecName: Full=Antimicrobial peptide 1; Short=AMP1; Flags: Precursor gi|4960199|gb|AAD34639.1|AF153915_1 antimicrobial protein precursor [Amaranthus hypochondriacus] gi|433863|emb|CAA51210.1| antimicrobial protein 2 [Amaranthus caudatus] Length = 86 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 4/69 (5%) Frame = +3 Query: 123 EPSMGAGECKHGKCPGGLCCSQYGYCGSGPAYCG----GVAEQRAALIQRTGSIPDGAKA 290 +PSMG GEC G+CP G+CCSQ+GYCG GP YCG V Q +T P AK Sbjct: 21 DPSMGVGECVRGRCPSGMCCSQFGYCGKGPKYCGRASTTVDHQADVAATKTAKNPTDAKL 80 Query: 291 AQVHGAGAP 317 A GAG+P Sbjct: 81 A---GAGSP 86 >emb|CBJ21249.1| AMP-2 precursor [Stellaria media] Length = 163 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 123 EPSMGAGECKHGKCPGGLCCSQYGYCGSGPAYCG 224 EP+ AG+C G+C GGLCCS+YGYCGSGPAYCG Sbjct: 65 EPT-AAGQCYRGRCSGGLCCSKYGYCGSGPAYCG 97 >gb|AAB22103.1| Ac-AMP1=antimicrobial peptide [Amaranthus caudatus, seeds, Peptide, 29 aa] Length = 29 Score = 59.3 bits (142), Expect = 5e-07 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +3 Query: 141 GECKHGKCPGGLCCSQYGYCGSGPAYCG 224 GEC G+CP G+CCSQ+GYCG GP YCG Sbjct: 2 GECVRGRCPSGMCCSQFGYCGKGPKYCG 29 >pdb|1MMC|A Chain A, 1h Nmr Study Of The Solution Structure Of Ac-Amp2 gi|299189|gb|AAB22102.1| Ac-AMP2=antimicrobial peptide [Amaranthus caudatus, seeds, Peptide, 30 aa] Length = 30 Score = 59.3 bits (142), Expect = 5e-07 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +3 Query: 141 GECKHGKCPGGLCCSQYGYCGSGPAYCG 224 GEC G+CP G+CCSQ+GYCG GP YCG Sbjct: 2 GECVRGRCPSGMCCSQFGYCGKGPKYCG 29 >pdb|1ZUV|A Chain A, 24 Nmr Structures Of Acamp2-Like Peptide With Phenylalanine 18 Mutated To Tryptophan Length = 30 Score = 58.9 bits (141), Expect = 7e-07 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +3 Query: 141 GECKHGKCPGGLCCSQYGYCGSGPAYCG 224 GEC G+CP G+CCSQ+GYCG GP YCG Sbjct: 2 GECVRGRCPSGMCCSQWGYCGKGPKYCG 29 >pdb|1ZWU|A Chain A, 30 Nmr Structures Of Acamp2-Like Peptide With Non Natural Beta-(2- Naphthyl)-Alanine Residue Length = 30 Score = 57.8 bits (138), Expect = 1e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +3 Query: 141 GECKHGKCPGGLCCSQYGYCGSGPAYCG 224 GEC G+CP G+CCSQ GYCG GP YCG Sbjct: 2 GECVRGRCPSGMCCSQXGYCGKGPKYCG 29 >gb|EMT18720.1| Endochitinase PR4 [Aegilops tauschii] Length = 82 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/71 (35%), Positives = 36/71 (50%) Frame = +3 Query: 126 PSMGAGECKHGKCPGGLCCSQYGYCGSGPAYCGGVAEQRAALIQRTGSIPDGAKAAQVHG 305 P+ G ++ CP G+CCSQ+GYCG+GP YCG + + +G+ AA Sbjct: 18 PAAGPAVAQNCNCPAGMCCSQWGYCGTGPDYCGAGCQSGPCTVASSGA------AAAEAS 71 Query: 306 AGAP*TVNSSP 338 G P N +P Sbjct: 72 VGKPVGSNRTP 82 >gb|EKD15207.1| AMP-1 precursor [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 111 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 141 GECKHGKCPGGLCCSQYGYCGSGPAYC-GGVAEQRAALIQRTGSIPDGAKAA 293 G C +G+C GLCCS YGYCG+GP YC GV Q A + + P+G+ AA Sbjct: 36 GSCVNGQCAAGLCCSPYGYCGTGPQYCTAGV--QPAPAQPPSNTFPEGSCAA 85