BLASTX nr result
ID: Ephedra25_contig00026984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00026984 (436 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001780259.1| predicted protein [Physcomitrella patens] gi... 77 2e-12 >ref|XP_001780259.1| predicted protein [Physcomitrella patens] gi|162668313|gb|EDQ54923.1| predicted protein [Physcomitrella patens] Length = 236 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/60 (60%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = +1 Query: 247 PVWPF-IRRHYIYSSNICDVDPVQLSELWAKTLEVRRDPERILKSLMHSYLFVIVLLRDE 423 P+WP I R +YS+N+ DVDPVQLSELW KTL V R+P +I+K+L HS++FVIVL E Sbjct: 29 PLWPIRIPRPLVYSTNLADVDPVQLSELWEKTLMVTREPSKIMKALRHSFMFVIVLAEQE 88