BLASTX nr result
ID: Ephedra25_contig00025421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00025421 (740 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002985463.1| hypothetical protein SELMODRAFT_122159 [Sela... 66 1e-08 >ref|XP_002985463.1| hypothetical protein SELMODRAFT_122159 [Selaginella moellendorffii] gi|300146926|gb|EFJ13593.1| hypothetical protein SELMODRAFT_122159 [Selaginella moellendorffii] Length = 711 Score = 65.9 bits (159), Expect = 1e-08 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 4/81 (4%) Frame = -1 Query: 428 GPGSPPARVSLAQENDPESPSFGKRPGPWPPQVGASPTDEDNNAKLKGNWARRTGFKST- 252 G SPP+R +DPESPS G+RPGPWPP++ A + N + G+WARRTGF+S Sbjct: 10 GTSSPPSRAQ--DHHDPESPSLGRRPGPWPPRMDAG---GNQNPRTMGSWARRTGFRSNM 64 Query: 251 ---GIHSTSSDFGLAPSTALI 198 ST SD ++ + A + Sbjct: 65 SGESAASTISDTDVSNADATL 85