BLASTX nr result
ID: Ephedra25_contig00025415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00025415 (404 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002982670.1| hypothetical protein SELMODRAFT_58009 [Selag... 57 2e-06 >ref|XP_002982670.1| hypothetical protein SELMODRAFT_58009 [Selaginella moellendorffii] gi|300149769|gb|EFJ16423.1| hypothetical protein SELMODRAFT_58009 [Selaginella moellendorffii] Length = 153 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/99 (31%), Positives = 55/99 (55%), Gaps = 2/99 (2%) Frame = +3 Query: 9 SLLHNFALHNSNGCVTTNAY--SYKQNGELQNTLNKAGFKLQIIPSGSEKKKIEKTMVGD 182 ++LH F N G +T +AY +Y+ +QN L G L IPSG K+ +K ++ + Sbjct: 34 NVLHAF---NFFGPLTISAYGDTYQLTRHVQNALTSTGISLNHIPSG-RKEASDKAILMN 89 Query: 183 VTLWITKNPPPANIIMLLGSSNMNKALQGLRDKGYKIFI 299 + W + NPPPAN++++ G + + L L+ K + + + Sbjct: 90 MAFWTSDNPPPANVVLISGDQDFSPLLHRLQMKRFNVLL 128