BLASTX nr result
ID: Ephedra25_contig00025170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00025170 (961 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840317.1| hypothetical protein AMTR_s00045p00081020 [A... 61 6e-07 >ref|XP_006840317.1| hypothetical protein AMTR_s00045p00081020 [Amborella trichopoda] gi|548842035|gb|ERN01992.1| hypothetical protein AMTR_s00045p00081020 [Amborella trichopoda] Length = 564 Score = 61.2 bits (147), Expect = 6e-07 Identities = 38/92 (41%), Positives = 54/92 (58%), Gaps = 2/92 (2%) Frame = -2 Query: 837 WVDRSLCFRGRKSVSEVPTILQKANQVGRQ--NKNGRKKNHGPKYSDKMSKVLPADFVKE 664 W++RSLC RGRKS+ ++ VG Q + G+KK+ ++KM + P D+VK+ Sbjct: 65 WINRSLCARGRKSM-----VVSGVANVGVQPIREEGKKKSRPAVRNNKMVQPSP-DYVKK 118 Query: 663 QVNYFQEVDSFELDEEDISFQQPGRDFNGRWQ 568 V+YF+EVD+F LDEE S GRWQ Sbjct: 119 WVSYFEEVDAFTLDEESAS-----PKVRGRWQ 145