BLASTX nr result
ID: Ephedra25_contig00025107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00025107 (624 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX93806.1| Tetratricopeptide repeat (TPR)-like superfamily p... 60 7e-07 ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Popu... 59 1e-06 ref|XP_004293124.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_004144398.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_002534359.1| pentatricopeptide repeat-containing protein,... 57 3e-06 >gb|EOX93806.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 382 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/84 (38%), Positives = 46/84 (54%) Frame = -2 Query: 326 PRDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTSY 147 PR L +FE IQKL FT ++D ++ Q + DLA DIF W+ Q +KH +Y Sbjct: 57 PRTRTPLETQFETWIQKLKPGFTTADVDAALRAQPDADLALDIFRWTALQRGYKHTDATY 116 Query: 146 IHILGLLWEVGRRDPALKLMKDVI 75 + I+ LL R A L+++VI Sbjct: 117 LTIIKLLISAKRYRHAETLIEEVI 140 >ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] gi|550345772|gb|EEE81080.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] Length = 387 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/78 (37%), Positives = 46/78 (58%) Frame = -2 Query: 308 LARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTSYIHILGL 129 L +FE Q L FT ++DT I+ Q++ DLA DIF W+ +Q +KH H +Y+ ++ + Sbjct: 66 LETQFETWTQNLKPGFTPTDVDTAIRAQSDPDLALDIFRWTAQQRNYKHNHITYLTVIKI 125 Query: 128 LWEVGRRDPALKLMKDVI 75 L R A L+++VI Sbjct: 126 LISGRRYRQAETLIEEVI 143 >ref|XP_004293124.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 370 Score = 58.5 bits (140), Expect = 1e-06 Identities = 32/104 (30%), Positives = 56/104 (53%) Frame = -2 Query: 386 PSLGMTKFETRYEKEPIKFAPRDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLA 207 PSL + P F R +E ++FE I KL F ++D ++ Q++ DLA Sbjct: 25 PSLYHRLLSSSARNPPDSFRTRTPLE--KQFETWIHKLKPGFGPPDVDEALKAQSDPDLA 82 Query: 206 HDIFNWSREQMRFKHKHTSYIHILGLLWEVGRRDPALKLMKDVI 75 DIF W+ +Q +KH H++Y+ ++ +L + R A L+++V+ Sbjct: 83 LDIFRWTAQQRNYKHSHSTYLTMIKILIDGRRYRHAETLLEEVV 126 >ref|XP_004144398.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Cucumis sativus] gi|449516331|ref|XP_004165200.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Cucumis sativus] Length = 393 Score = 57.4 bits (137), Expect = 3e-06 Identities = 41/145 (28%), Positives = 72/145 (49%) Frame = -2 Query: 509 SPFQSSKLANPSGFPSYPNNNSNSRILTPRAWTMQRRRKHAPSLGMTKFETRYEKEPIKF 330 SPFQS L NP PS+ ++ + P + + + +L + K T+ Sbjct: 21 SPFQS--LLNPI-LPSHLHHRFLCSLSPPSSALLPPQNSDNLNLPIPKVRTQ-------- 69 Query: 329 APRDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTS 150 L ++FE +QKL F+ +++ +Q Q++ DLA D+F W+ +Q +KH H + Sbjct: 70 -----TPLEKQFESWVQKLKPGFSPSDVNEALQAQSDPDLALDLFRWTAQQRGYKHNHLT 124 Query: 149 YIHILGLLWEVGRRDPALKLMKDVI 75 Y+ I+ +L R A L+++VI Sbjct: 125 YLTIIKILIYRRRCHLAETLVEEVI 149 >ref|XP_002534359.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223525434|gb|EEF28024.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 382 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/83 (33%), Positives = 47/83 (56%) Frame = -2 Query: 323 RDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTSYI 144 R L +FE Q L FT ++ T ++ Q++ DLA+DIF W+ +Q +KH H +Y Sbjct: 56 RTRTPLETQFETWTQTLKPGFTPTDVQTALRSQSDPDLAYDIFRWTAQQRNYKHSHLTYF 115 Query: 143 HILGLLWEVGRRDPALKLMKDVI 75 ++ +L + R A L+++VI Sbjct: 116 AMIKILIDGKRYRHAETLVEEVI 138