BLASTX nr result
ID: Ephedra25_contig00023331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00023331 (656 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006434030.1| hypothetical protein CICLE_v10003725mg, part... 62 2e-07 gb|EMJ20585.1| hypothetical protein PRUPE_ppa020228mg [Prunus pe... 57 6e-06 ref|XP_003597941.1| hypothetical protein MTR_2g104240 [Medicago ... 57 6e-06 >ref|XP_006434030.1| hypothetical protein CICLE_v10003725mg, partial [Citrus clementina] gi|557536152|gb|ESR47270.1| hypothetical protein CICLE_v10003725mg, partial [Citrus clementina] Length = 121 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = -1 Query: 206 SKASLIH-QSGAAEAWWAHNPQVPGSKPGSDMKSACKHP--KTNIFYLFSPLH 57 SK+ L++ QSGAAEAWWAHNPQVPGSKPGSD KS ++P + FY+F+ ++ Sbjct: 70 SKSRLVNNQSGAAEAWWAHNPQVPGSKPGSD-KSGFQNPHIREPEFYIFNIIY 121 >gb|EMJ20585.1| hypothetical protein PRUPE_ppa020228mg [Prunus persica] Length = 91 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 5/45 (11%) Frame = -1 Query: 185 QSGAAEAWWAHNPQVPGSKPGSDM-----KSACKHPKTNIFYLFS 66 +SGAAEAWWAHNPQVPGSKPGSDM K P IF+L++ Sbjct: 25 RSGAAEAWWAHNPQVPGSKPGSDMSGFRFKPFFVGPIFAIFFLYA 69 >ref|XP_003597941.1| hypothetical protein MTR_2g104240 [Medicago truncatula] gi|355486989|gb|AES68192.1| hypothetical protein MTR_2g104240 [Medicago truncatula] Length = 78 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 194 LIHQSGAAEAWWAHNPQVPGSKPGSD 117 + +QSGAAEAWWAHNPQVPGSKPGSD Sbjct: 25 ITNQSGAAEAWWAHNPQVPGSKPGSD 50