BLASTX nr result
ID: Ephedra25_contig00022199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00022199 (458 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ25657.1| hypothetical protein PRUPE_ppa022210mg [Prunus pe... 55 7e-06 >gb|EMJ25657.1| hypothetical protein PRUPE_ppa022210mg [Prunus persica] Length = 484 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 8/65 (12%) Frame = -3 Query: 228 MGRTTRWLRSLLGGKKDSKQHELQQQHSCVPSPSKSFG--------IDESKNFPKEKRRW 73 MG+T +WLRS L GKKD ++ + + + C + S S I S+ PKEKRRW Sbjct: 1 MGKTGKWLRSFLTGKKDKEKDKEKDKEKCPTNQSCSVASHENPTTPISNSQTTPKEKRRW 60 Query: 72 SFRRS 58 SFRRS Sbjct: 61 SFRRS 65