BLASTX nr result
ID: Ephedra25_contig00022183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00022183 (451 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK20994.1| unknown [Picea sitchensis] 79 5e-13 gb|EPS58641.1| hypothetical protein M569_16174 [Genlisea aurea] 57 3e-06 >gb|ABK20994.1| unknown [Picea sitchensis] Length = 52 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = -3 Query: 338 MRESQAKAPIDNSWLVHYTPFIVVALILAHLIAFVYWIVRVAIEKPSERRKTH 180 MRE Q K +++SW+V Y PF+VVALI+AHL+AFVYWI RVA+EKP ERRKTH Sbjct: 1 MREVQKKI-VEHSWIVEYVPFMVVALIVAHLLAFVYWIYRVAMEKPPERRKTH 52 >gb|EPS58641.1| hypothetical protein M569_16174 [Genlisea aurea] Length = 52 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/53 (45%), Positives = 35/53 (66%) Frame = -3 Query: 338 MRESQAKAPIDNSWLVHYTPFIVVALILAHLIAFVYWIVRVAIEKPSERRKTH 180 M Q KAPI W + + P ++V L++AH++A VYWI R+A +K +RRK H Sbjct: 1 MANFQQKAPI-RPWFIDFVPLMIVVLVVAHVLALVYWIYRLATDKQPQRRKVH 52