BLASTX nr result
ID: Ephedra25_contig00017896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00017896 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489189.1| PREDICTED: 54S ribosomal protein L39, mitoch... 60 2e-07 gb|EOY06356.1| Ribosomal protein L33 family protein [Theobroma c... 60 3e-07 gb|EMT32803.1| 50S ribosomal protein L33 [Aegilops tauschii] 60 3e-07 ref|NP_001055710.1| Os05g0452600 [Oryza sativa Japonica Group] g... 60 3e-07 ref|XP_006407961.1| hypothetical protein EUTSA_v10022246mg, part... 60 4e-07 ref|XP_006400432.1| hypothetical protein EUTSA_v10015229mg [Eutr... 60 4e-07 gb|ABK21647.1| unknown [Picea sitchensis] gi|116780944|gb|ABK218... 60 4e-07 ref|XP_006299449.1| hypothetical protein CARUB_v10015614mg [Caps... 59 5e-07 ref|NP_187283.1| ribosomal protein L33 family protein [Arabidops... 59 5e-07 ref|XP_006115771.1| PREDICTED: 39S ribosomal protein L33, mitoch... 59 7e-07 ref|XP_005851290.1| hypothetical protein CHLNCDRAFT_19156 [Chlor... 58 1e-06 gb|ABK21866.1| unknown [Picea sitchensis] 58 1e-06 gb|ADR71262.1| 50S ribosomal protein L33A [Hevea brasiliensis] 57 2e-06 ref|XP_004296781.1| PREDICTED: 50S ribosomal protein L33-like [F... 57 3e-06 gb|ACG30463.1| 50S ribosomal protein L33 [Zea mays] 57 3e-06 ref|XP_002314445.1| ribosomal protein L33 [Populus trichocarpa] ... 57 3e-06 ref|XP_002516842.1| structural constituent of ribosome, putative... 56 4e-06 ref|YP_003950485.1| 50S ribosomal protein L33 [Stigmatella auran... 56 4e-06 gb|AAU93952.1| 50S ribosomal protein L33 [Helicosporidium sp. ex... 56 6e-06 ref|XP_003787537.1| PREDICTED: 39S ribosomal protein L33, mitoch... 55 1e-05 >ref|XP_006489189.1| PREDICTED: 54S ribosomal protein L39, mitochondrial-like isoform X1 [Citrus sinensis] gi|568872054|ref|XP_006489190.1| PREDICTED: 54S ribosomal protein L39, mitochondrial-like isoform X2 [Citrus sinensis] gi|568872056|ref|XP_006489191.1| PREDICTED: 54S ribosomal protein L39, mitochondrial-like isoform X3 [Citrus sinensis] Length = 57 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -3 Query: 329 MGFPKRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 MG K+ ++ +++S AGTGF Y RK ++ EK+E KYDP VNRHVLF E Sbjct: 1 MGDKKKTFMFVRLVSAAGTGFFYVKRKSAKKVLEKLEFRKYDPRVNRHVLFTE 53 >gb|EOY06356.1| Ribosomal protein L33 family protein [Theobroma cacao] Length = 58 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVEQPVE 159 K+ ++ +++S AGTGF Y RK ++ EK+E KYDP VNRHVLF EQ ++ Sbjct: 6 KKTFMFIRLVSAAGTGFFYVKRKSAKKVAEKLEFRKYDPRVNRHVLFTEQKMK 58 >gb|EMT32803.1| 50S ribosomal protein L33 [Aegilops tauschii] Length = 86 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -3 Query: 329 MGFPKRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 MG KR + +++S AGTGF Y RK R+ EK+E KYDP VN+HVLF E Sbjct: 1 MGKAKRASIFIRLVSAAGTGFFYVKRKNPRRITEKLEFRKYDPRVNKHVLFTE 53 >ref|NP_001055710.1| Os05g0452600 [Oryza sativa Japonica Group] gi|226493452|ref|NP_001150073.1| LOC100283702 [Zea mays] gi|242088467|ref|XP_002440066.1| hypothetical protein SORBIDRAFT_09g025380 [Sorghum bicolor] gi|357133012|ref|XP_003568122.1| PREDICTED: 50S ribosomal protein L33-like [Brachypodium distachyon] gi|357136557|ref|XP_003569870.1| PREDICTED: 50S ribosomal protein L33-like [Brachypodium distachyon] gi|514748027|ref|XP_004961515.1| PREDICTED: 39S ribosomal protein L33, mitochondrial-like [Setaria italica] gi|113579261|dbj|BAF17624.1| Os05g0452600 [Oryza sativa Japonica Group] gi|195629488|gb|ACG36385.1| 50S ribosomal protein L33 [Zea mays] gi|195636476|gb|ACG37706.1| 50S ribosomal protein L33 [Zea mays] gi|195637860|gb|ACG38398.1| 50S ribosomal protein L33 [Zea mays] gi|195656701|gb|ACG47818.1| 50S ribosomal protein L33 [Zea mays] gi|218196895|gb|EEC79322.1| hypothetical protein OsI_20170 [Oryza sativa Indica Group] gi|218197095|gb|EEC79522.1| hypothetical protein OsI_20605 [Oryza sativa Indica Group] gi|222632209|gb|EEE64341.1| hypothetical protein OsJ_19181 [Oryza sativa Japonica Group] gi|223975085|gb|ACN31730.1| unknown [Zea mays] gi|241945351|gb|EES18496.1| hypothetical protein SORBIDRAFT_09g025380 [Sorghum bicolor] gi|413946041|gb|AFW78690.1| hypothetical protein ZEAMMB73_147625 [Zea mays] gi|413946042|gb|AFW78691.1| hypothetical protein ZEAMMB73_147625 [Zea mays] gi|413946043|gb|AFW78692.1| hypothetical protein ZEAMMB73_147625 [Zea mays] gi|413946044|gb|AFW78693.1| hypothetical protein ZEAMMB73_147625 [Zea mays] gi|474195996|gb|EMS58366.1| 50S ribosomal protein L33 [Triticum urartu] gi|474407096|gb|EMS66535.1| 50S ribosomal protein L33 [Triticum urartu] Length = 57 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -3 Query: 329 MGFPKRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 MG KR + +++S AGTGF Y RK R+ EK+E KYDP VN+HVLF E Sbjct: 1 MGKAKRASIFIRLVSAAGTGFFYVKRKNPRRITEKLEFRKYDPRVNKHVLFTE 53 >ref|XP_006407961.1| hypothetical protein EUTSA_v10022246mg, partial [Eutrema salsugineum] gi|557109107|gb|ESQ49414.1| hypothetical protein EUTSA_v10022246mg, partial [Eutrema salsugineum] Length = 95 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVEQPVE 159 K+ ++ +++S AGTGF Y RK L EK+E KYDP VNRHVLF EQ ++ Sbjct: 43 KKTFMFIRLVSAAGTGFFYVKRKSSKGLLEKLEFRKYDPRVNRHVLFTEQKMK 95 >ref|XP_006400432.1| hypothetical protein EUTSA_v10015229mg [Eutrema salsugineum] gi|567175443|ref|XP_006400433.1| hypothetical protein EUTSA_v10015229mg [Eutrema salsugineum] gi|557101522|gb|ESQ41885.1| hypothetical protein EUTSA_v10015229mg [Eutrema salsugineum] gi|557101523|gb|ESQ41886.1| hypothetical protein EUTSA_v10015229mg [Eutrema salsugineum] Length = 58 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVEQPVE 159 K+ ++ +++S AGTGF Y RK L EK+E KYDP VNRHVLF EQ ++ Sbjct: 6 KKTFMFIRLVSAAGTGFFYVKRKSSKGLLEKLEFRKYDPRVNRHVLFTEQKMK 58 >gb|ABK21647.1| unknown [Picea sitchensis] gi|116780944|gb|ABK21892.1| unknown [Picea sitchensis] Length = 57 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/53 (52%), Positives = 36/53 (67%) Frame = -3 Query: 329 MGFPKRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 MG K ++ +++S+AGTGF Y RK +L EK+E KYDP VNRHVLF E Sbjct: 1 MGKAKGGSILIRLVSSAGTGFFYVKRKNPRKLPEKLEFRKYDPRVNRHVLFTE 53 >ref|XP_006299449.1| hypothetical protein CARUB_v10015614mg [Capsella rubella] gi|482568158|gb|EOA32347.1| hypothetical protein CARUB_v10015614mg [Capsella rubella] Length = 97 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVEQPVE 159 K+ ++ +++S AGTGF Y RK L EK+E KYDP VNRHVLF EQ ++ Sbjct: 45 KKTFMFIRLVSAAGTGFFYVKRKSTKGLLEKLEFRKYDPRVNRHVLFTEQKMK 97 >ref|NP_187283.1| ribosomal protein L33 family protein [Arabidopsis thaliana] gi|15239562|ref|NP_197380.1| ribosomal protein L33 family protein [Arabidopsis thaliana] gi|297812063|ref|XP_002873915.1| ribosomal protein L33 family protein [Arabidopsis lyrata subsp. lyrata] gi|297829162|ref|XP_002882463.1| ribosomal protein L33 family protein [Arabidopsis lyrata subsp. lyrata] gi|6437554|gb|AAF08581.1|AC011623_14 putative 50S ribosomal protein L33 [Arabidopsis thaliana] gi|21536699|gb|AAM61031.1| ribosomal protein L33-like [Arabidopsis thaliana] gi|38566500|gb|AAR24140.1| At5g18790 [Arabidopsis thaliana] gi|40823687|gb|AAR92299.1| At5g18790 [Arabidopsis thaliana] gi|51969692|dbj|BAD43538.1| putative 50S ribosomal protein L33 [Arabidopsis thaliana] gi|109134211|gb|ABG25103.1| At3g06320 [Arabidopsis thaliana] gi|297319752|gb|EFH50174.1| ribosomal protein L33 family protein [Arabidopsis lyrata subsp. lyrata] gi|297328303|gb|EFH58722.1| ribosomal protein L33 family protein [Arabidopsis lyrata subsp. lyrata] gi|332005229|gb|AED92612.1| ribosomal protein L33 family protein [Arabidopsis thaliana] gi|332640853|gb|AEE74374.1| ribosomal protein L33 family protein [Arabidopsis thaliana] Length = 58 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVEQPVE 159 K+ ++ +++S AGTGF Y RK L EK+E KYDP VNRHVLF EQ ++ Sbjct: 6 KKTFMFIRLVSAAGTGFFYVKRKSTKGLLEKLEFRKYDPRVNRHVLFTEQKMK 58 >ref|XP_006115771.1| PREDICTED: 39S ribosomal protein L33, mitochondrial, partial [Pelodiscus sinensis] Length = 63 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/50 (54%), Positives = 39/50 (78%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVEQ 168 K YV+ +M+S AGTG+ Y I+K +RL EK+ +LKYDP+VN+ VLF+E+ Sbjct: 10 KSKYVLVRMVSAAGTGYSYNIKK--ARLQEKLVLLKYDPIVNKRVLFIEK 57 >ref|XP_005851290.1| hypothetical protein CHLNCDRAFT_19156 [Chlorella variabilis] gi|307110953|gb|EFN59188.1| hypothetical protein CHLNCDRAFT_19156 [Chlorella variabilis] Length = 57 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = -3 Query: 329 MGFPKRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 M K ++ K+LSTAGTG+ Y RK +L +K+E +KYDP V RHVLF E Sbjct: 1 MAGKKAATLLVKLLSTAGTGYFYVARKNPRKLPQKLEFVKYDPRVRRHVLFTE 53 >gb|ABK21866.1| unknown [Picea sitchensis] Length = 57 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = -3 Query: 329 MGFPKRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 MG K ++ +++S+ GTGF Y RK +L EK+E KYDP VNRHVLF E Sbjct: 1 MGKAKGGSILIRLVSSPGTGFFYVKRKNPRKLPEKLEFRKYDPRVNRHVLFTE 53 >gb|ADR71262.1| 50S ribosomal protein L33A [Hevea brasiliensis] Length = 62 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 K+ ++ +++S AGTGF Y RK ++ EK+E KYDP VNRHVLF E Sbjct: 10 KKTFMFIRLVSAAGTGFFYVKRKSFKKITEKLEFRKYDPRVNRHVLFTE 58 >ref|XP_004296781.1| PREDICTED: 50S ribosomal protein L33-like [Fragaria vesca subsp. vesca] Length = 57 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 K+ + +++S AGTGF +Y++K+ SR+ EK+E KYDP VNRHVLF E Sbjct: 6 KKATLFIRLVSAAGTGF-FYVKKKPSRMVEKLEFRKYDPRVNRHVLFTE 53 >gb|ACG30463.1| 50S ribosomal protein L33 [Zea mays] Length = 57 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = -3 Query: 329 MGFPKRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 MG KR + +++S AGTGF Y RK R+ EK+E K DP VN+HVLF E Sbjct: 1 MGKAKRASIFIRLVSAAGTGFFYVKRKNPRRITEKLEFRKXDPRVNKHVLFTE 53 >ref|XP_002314445.1| ribosomal protein L33 [Populus trichocarpa] gi|118481950|gb|ABK92907.1| unknown [Populus trichocarpa] gi|222863485|gb|EEF00616.1| ribosomal protein L33 [Populus trichocarpa] Length = 58 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 K+ ++ +++S AGTGF Y RK + EK+E KYDP VNRHVLF E Sbjct: 6 KKTFMFIRLVSAAGTGFFYVKRKSAKKALEKLEFRKYDPRVNRHVLFTE 54 >ref|XP_002516842.1| structural constituent of ribosome, putative [Ricinus communis] gi|223543930|gb|EEF45456.1| structural constituent of ribosome, putative [Ricinus communis] Length = 58 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 K+ ++ +++S AGTGF Y RK ++ EK+E K+DP VNRHVLF E Sbjct: 6 KKTFMFIRLVSAAGTGFFYVKRKSAKKVAEKLEFRKFDPRVNRHVLFTE 54 >ref|YP_003950485.1| 50S ribosomal protein L33 [Stigmatella aurantiaca DW4/3-1] gi|488689816|ref|WP_002614002.1| 50S ribosomal protein L33 [Stigmatella aurantiaca] gi|115367473|gb|EAU66449.1| ribosomal protein L33 [Stigmatella aurantiaca DW4/3-1] gi|309391199|gb|ADO68658.1| 50S ribosomal protein L33 [Stigmatella aurantiaca DW4/3-1] Length = 54 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -3 Query: 320 PKRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 PK + I ++STAGTGF Y K K + EK+E KYDP V +HVLFVE Sbjct: 2 PKGNRTIIHLVSTAGTGFFYTTTKNKRKSQEKLEKKKYDPRVRKHVLFVE 51 >gb|AAU93952.1| 50S ribosomal protein L33 [Helicosporidium sp. ex Simulium jonesi] Length = 58 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = -3 Query: 305 VIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVE 171 ++ K+LS+AGTGF Y +K + +K+E +K+DP VNRHVLFVE Sbjct: 10 ILVKLLSSAGTGFFYVAKKNPRKNPKKLEFVKHDPRVNRHVLFVE 54 >ref|XP_003787537.1| PREDICTED: 39S ribosomal protein L33, mitochondrial [Otolemur garnettii] Length = 65 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = -3 Query: 317 KRDYVIAKMLSTAGTGFHYYIRKQKSRLHEKIEILKYDPMVNRHVLFVEQ 168 K +++ KMLS AGTG Y+ ++SRL EK+ +L+YDP+V + VLFVE+ Sbjct: 12 KSKHILVKMLSQAGTG--YFFNVKRSRLREKLTVLRYDPVVRKRVLFVEE 59