BLASTX nr result
ID: Ephedra25_contig00017110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00017110 (597 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60905.1| hypothetical protein VITISV_028449 [Vitis vinifera] 40 5e-07 >emb|CAN60905.1| hypothetical protein VITISV_028449 [Vitis vinifera] Length = 1609 Score = 40.0 bits (92), Expect(2) = 5e-07 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 10/90 (11%) Frame = +2 Query: 224 EQLVIRYISEDDFQVFASTLKSVNASKLSKE----DETDYAAEAV------RFVQLVCKF 373 E+ +I+ I DD F + K + + ++E DE + E + + +Q C+F Sbjct: 570 EKSLIKSIWRDDRAQFLTQSKRLFQNPENRESLEDDENRDSPELLDRSIVAKLLQWCCRF 629 Query: 374 YSVTCTVSNLEGALGFHVPVNSADENGKTA 463 SV C + L GA+G +N DENG+TA Sbjct: 630 DSVDCATALLNGAVGMLPLINEMDENGRTA 659 Score = 39.7 bits (91), Expect(2) = 5e-07 Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +3 Query: 483 AVYGHSISCIRFLLGKHARIDLKSKDG--QLPLDLALCSK 596 A H+ C+ LL K AR DLKSKDG QL L+L+L S+ Sbjct: 663 AAEAHAARCVELLLRKRARTDLKSKDGCSQLALELSLSSR 702