BLASTX nr result
ID: Ephedra25_contig00016781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00016781 (728 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634352.1| PREDICTED: RNA pseudourine synthase 2, chlor... 65 3e-08 gb|ACG41877.1| RNA binding protein [Zea mays] 65 3e-08 ref|XP_003603819.1| RNA pseudourine synthase [Medicago truncatul... 65 3e-08 emb|CAN66750.1| hypothetical protein VITISV_034413 [Vitis vinifera] 65 3e-08 ref|XP_004161095.1| PREDICTED: LOW QUALITY PROTEIN: RNA pseudour... 64 7e-08 ref|XP_004143077.1| PREDICTED: RNA pseudourine synthase 2, chlor... 64 7e-08 ref|XP_003523282.1| PREDICTED: RNA pseudouridine synthase 2, chl... 64 7e-08 ref|XP_006473714.1| PREDICTED: RNA pseudouridine synthase 2, chl... 63 9e-08 ref|XP_006828851.1| hypothetical protein AMTR_s00001p00157430 [A... 63 1e-07 ref|XP_004500918.1| PREDICTED: RNA pseudourine synthase 2, chlor... 63 1e-07 ref|XP_002301949.1| pseudouridine synthase family protein [Popul... 63 1e-07 gb|ESW08114.1| hypothetical protein PHAVU_009G019500g [Phaseolus... 62 2e-07 gb|ESW08113.1| hypothetical protein PHAVU_009G019500g [Phaseolus... 62 2e-07 ref|XP_006656497.1| PREDICTED: RNA pseudouridine synthase 2, chl... 61 3e-07 ref|XP_003563280.1| PREDICTED: RNA pseudourine synthase 2, chlor... 61 3e-07 ref|XP_002439034.1| hypothetical protein SORBIDRAFT_10g030300 [S... 60 6e-07 ref|XP_006390244.1| hypothetical protein EUTSA_v10018588mg [Eutr... 60 7e-07 ref|XP_002977737.1| hypothetical protein SELMODRAFT_107344 [Sela... 60 9e-07 ref|XP_002977735.1| hypothetical protein SELMODRAFT_107717 [Sela... 60 9e-07 ref|XP_004966473.1| PREDICTED: RNA pseudouridine synthase 2, chl... 59 1e-06 >ref|XP_003634352.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Vitis vinifera] gi|302141717|emb|CBI18920.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA +LGF HP+TG+ V FSC PP+DF ++L++LRK+ Sbjct: 383 DRPCLHAVALGFNHPKTGKNVHFSCQPPEDFAEILSWLRKI 423 >gb|ACG41877.1| RNA binding protein [Zea mays] Length = 439 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA SLGF+HPR+G+ + FSCPPP DF++VL LR++ Sbjct: 386 DRPCLHAASLGFKHPRSGKVLEFSCPPPDDFLEVLGELRRV 426 >ref|XP_003603819.1| RNA pseudourine synthase [Medicago truncatula] gi|355492867|gb|AES74070.1| RNA pseudourine synthase [Medicago truncatula] Length = 465 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA +LGF+HP TGE+V FSC PP DF D+L+ LR++ Sbjct: 408 DRPCLHASTLGFQHPHTGEQVHFSCEPPVDFNDILSQLRRI 448 >emb|CAN66750.1| hypothetical protein VITISV_034413 [Vitis vinifera] Length = 611 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA +LGF HP+TG+ V FSC PP+DF ++L++LRK+ Sbjct: 529 DRPCLHAVALGFNHPKTGKNVHFSCQPPEDFAEILSWLRKI 569 >ref|XP_004161095.1| PREDICTED: LOW QUALITY PROTEIN: RNA pseudourine synthase 2, chloroplastic-like [Cucumis sativus] Length = 452 Score = 63.5 bits (153), Expect = 7e-08 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 ERPCLHA +LGF HP TG+ + FSCPPP DF ++L+ LR++ Sbjct: 381 ERPCLHALTLGFVHPHTGKNIRFSCPPPTDFTEILSQLREI 421 >ref|XP_004143077.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Cucumis sativus] Length = 453 Score = 63.5 bits (153), Expect = 7e-08 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 ERPCLHA +LGF HP TG+ + FSCPPP DF ++L+ LR++ Sbjct: 382 ERPCLHALTLGFVHPHTGKNIRFSCPPPTDFTEILSQLREI 422 >ref|XP_003523282.1| PREDICTED: RNA pseudouridine synthase 2, chloroplastic-like isoform X1 [Glycine max] gi|571448797|ref|XP_006577958.1| PREDICTED: RNA pseudouridine synthase 2, chloroplastic-like isoform X2 [Glycine max] Length = 450 Score = 63.5 bits (153), Expect = 7e-08 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA +LGF+HP TGE+V FSC PP DF ++L+ LR++ Sbjct: 397 DRPCLHAWTLGFQHPHTGEQVHFSCEPPADFAEILSQLRRI 437 >ref|XP_006473714.1| PREDICTED: RNA pseudouridine synthase 2, chloroplastic-like [Citrus sinensis] Length = 421 Score = 63.2 bits (152), Expect = 9e-08 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA +LGF HP T EK+ FSCPPP DF ++L+ LR++ Sbjct: 373 QRPCLHAVALGFTHPHTREKIQFSCPPPADFAEILSQLREI 413 >ref|XP_006828851.1| hypothetical protein AMTR_s00001p00157430 [Amborella trichopoda] gi|548833830|gb|ERM96267.1| hypothetical protein AMTR_s00001p00157430 [Amborella trichopoda] Length = 452 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKLK 602 +RPCLHA SLGF+HP + E VLF+CPPP DF +VL L+ ++ Sbjct: 391 QRPCLHAFSLGFKHPHSKENVLFTCPPPPDFAEVLRQLQSIR 432 >ref|XP_004500918.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Cicer arietinum] Length = 438 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA +LGF+HP TGE+V FSC PP DF ++L+ LR++ Sbjct: 395 DRPCLHAMTLGFQHPHTGEQVHFSCEPPVDFNEILSQLRRI 435 >ref|XP_002301949.1| pseudouridine synthase family protein [Populus trichocarpa] gi|222843675|gb|EEE81222.1| pseudouridine synthase family protein [Populus trichocarpa] Length = 444 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 ERPCLHA +LGF HP TG+++ FSCPPP DF ++L+ LR++ Sbjct: 395 ERPCLHALALGFTHPCTGKEIHFSCPPPPDFTEILSQLREM 435 >gb|ESW08114.1| hypothetical protein PHAVU_009G019500g [Phaseolus vulgaris] Length = 447 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA +LGF+HP TGE+V FSC PP DF ++L+ LR++ Sbjct: 394 DRPCLHALTLGFQHPHTGEQVHFSCEPPVDFDEILSQLRRI 434 >gb|ESW08113.1| hypothetical protein PHAVU_009G019500g [Phaseolus vulgaris] Length = 458 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA +LGF+HP TGE+V FSC PP DF ++L+ LR++ Sbjct: 405 DRPCLHALTLGFQHPHTGEQVHFSCEPPVDFDEILSQLRRI 445 >ref|XP_006656497.1| PREDICTED: RNA pseudouridine synthase 2, chloroplastic-like [Oryza brachyantha] Length = 442 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA LGF+HP +G+ + FSCPPP DF +VLN LR++ Sbjct: 386 DRPCLHAALLGFKHPHSGKILEFSCPPPDDFTEVLNELRRV 426 >ref|XP_003563280.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Brachypodium distachyon] Length = 439 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKLKGVS*SLQTG 575 +RPCLHA LGF+HP +G+ + FSCPPP DF +VL+ LR++ S S G Sbjct: 383 DRPCLHAALLGFKHPHSGKMLEFSCPPPDDFAEVLDELRRVTPTSDSQDGG 433 >ref|XP_002439034.1| hypothetical protein SORBIDRAFT_10g030300 [Sorghum bicolor] gi|241917257|gb|EER90401.1| hypothetical protein SORBIDRAFT_10g030300 [Sorghum bicolor] Length = 441 Score = 60.5 bits (145), Expect = 6e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA LGF+HP +G+ + FSCPPP DF +VL+ LRK+ Sbjct: 389 DRPCLHAALLGFKHPHSGKILEFSCPPPDDFSEVLDELRKV 429 >ref|XP_006390244.1| hypothetical protein EUTSA_v10018588mg [Eutrema salsugineum] gi|557086678|gb|ESQ27530.1| hypothetical protein EUTSA_v10018588mg [Eutrema salsugineum] Length = 432 Score = 60.1 bits (144), Expect = 7e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRK 608 +RPCLHA LGFEHP TGE V FSCPPP D +++ LR+ Sbjct: 386 DRPCLHAIVLGFEHPCTGEVVKFSCPPPSDLAEIVGLLRR 425 >ref|XP_002977737.1| hypothetical protein SELMODRAFT_107344 [Selaginella moellendorffii] gi|300154440|gb|EFJ21075.1| hypothetical protein SELMODRAFT_107344 [Selaginella moellendorffii] Length = 421 Score = 59.7 bits (143), Expect = 9e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -2 Query: 724 RPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKLK 602 RPCLHA+SLGFEHP T + V F+CPPP+DF + LR +K Sbjct: 378 RPCLHAYSLGFEHPATEKYVHFTCPPPEDFEEAWTRLRDMK 418 >ref|XP_002977735.1| hypothetical protein SELMODRAFT_107717 [Selaginella moellendorffii] gi|300154438|gb|EFJ21073.1| hypothetical protein SELMODRAFT_107717 [Selaginella moellendorffii] Length = 191 Score = 59.7 bits (143), Expect = 9e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -2 Query: 724 RPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKLK 602 RPCLHA+SLGFEHP T + V F+CPPP+DF + LR +K Sbjct: 148 RPCLHAYSLGFEHPATEKYVHFTCPPPEDFEEAWTRLRDMK 188 >ref|XP_004966473.1| PREDICTED: RNA pseudouridine synthase 2, chloroplastic-like [Setaria italica] Length = 437 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -2 Query: 727 ERPCLHAHSLGFEHPRTGEKVLFSCPPPQDFMDVLNYLRKL 605 +RPCLHA LGF+HP +G+ + FSCPPP DF +VL+ LR++ Sbjct: 384 DRPCLHAALLGFKHPHSGKILEFSCPPPDDFTEVLDELRRV 424