BLASTX nr result
ID: Ephedra25_contig00014077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00014077 (598 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY29324.1| Uncharacterized protein TCM_036899 [Theobroma cacao] 61 3e-07 ref|XP_002529404.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 gb|EMJ05949.1| hypothetical protein PRUPE_ppa013045mg [Prunus pe... 56 8e-06 >gb|EOY29324.1| Uncharacterized protein TCM_036899 [Theobroma cacao] Length = 227 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = -1 Query: 190 KHANLLEDFVQLQKEFSEMKDHLESVKEKRTRLLAEVRFLRRRFQTLKQSQEEPN 26 KH NLL++F++LQKEF K L++V +KR LLAEVRFLR+RF L + + N Sbjct: 83 KHQNLLQEFLELQKEFVSKKKKLQTVNQKRETLLAEVRFLRQRFSYLSMIKSQEN 137 >ref|XP_002529404.1| conserved hypothetical protein [Ricinus communis] gi|223531152|gb|EEF33000.1| conserved hypothetical protein [Ricinus communis] Length = 262 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/77 (40%), Positives = 41/77 (53%) Frame = -1 Query: 253 AMSIKRPGLGAGFISSPMEASKHANLLEDFVQLQKEFSEMKDHLESVKEKRTRLLAEVRF 74 AM P + A P KH L++DF +L KE + K L+ +K K+ LLAEVRF Sbjct: 9 AMESSSPSIYATLYEDPRARLKHQTLMQDFEELYKETEDQKKKLQMMKHKKLTLLAEVRF 68 Query: 73 LRRRFQTLKQSQEEPNA 23 LR+RF+ L Q A Sbjct: 69 LRQRFKYLMLDQSHTPA 85 >gb|EMJ05949.1| hypothetical protein PRUPE_ppa013045mg [Prunus persica] Length = 142 Score = 55.8 bits (133), Expect = 8e-06 Identities = 29/77 (37%), Positives = 48/77 (62%) Frame = -1 Query: 235 PGLGAGFISSPMEASKHANLLEDFVQLQKEFSEMKDHLESVKEKRTRLLAEVRFLRRRFQ 56 P AG+ P KH +L++D+ +LQK+ MK L+ +K+K++ LLAEVRFL RR++ Sbjct: 12 PSSYAGY-EDPRTRFKHQSLMQDYEELQKDAEAMKKKLQMMKQKKSTLLAEVRFLSRRYK 70 Query: 55 TLKQSQEEPNANKISLI 5 L +Q + K +++ Sbjct: 71 YLMGNQSMNSRQKQAVV 87