BLASTX nr result
ID: Ephedra25_contig00013640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00013640 (514 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838330.1| hypothetical protein AMTR_s00103p00143950 [A... 55 7e-06 >ref|XP_006838330.1| hypothetical protein AMTR_s00103p00143950 [Amborella trichopoda] gi|548840798|gb|ERN00899.1| hypothetical protein AMTR_s00103p00143950 [Amborella trichopoda] Length = 436 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/68 (35%), Positives = 42/68 (61%) Frame = -3 Query: 494 QSSSQDIEIYPGHSTTLLDKKLRVYGGLMPDGRASGNMHIVDLSTIKGGAPGRTQGLQFG 315 Q ++ I + GH +D+K+ ++GG G+ S ++++D S++KGGAPGRT+GL Sbjct: 363 QHCTKSIVLPKGHLVLEMDQKVLIHGGTTEQGKPSNILYVLDASSLKGGAPGRTKGLNIY 422 Query: 314 TLDQNKNG 291 +D + G Sbjct: 423 AIDSVEGG 430