BLASTX nr result
ID: Ephedra25_contig00013628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00013628 (796 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515726.1| conserved hypothetical protein [Ricinus comm... 58 4e-06 >ref|XP_002515726.1| conserved hypothetical protein [Ricinus communis] gi|223545163|gb|EEF46673.1| conserved hypothetical protein [Ricinus communis] Length = 473 Score = 57.8 bits (138), Expect = 4e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -3 Query: 794 MIRRFQWVFFRVENEWNKMALKQNLQNPMKEVDSTEKEHLL 672 M+RRFQWVFFRVENEWNKM K ++Q M E+ S E + L+ Sbjct: 427 MVRRFQWVFFRVENEWNKMTSKSSIQLQMNEISSEEAKLLV 467