BLASTX nr result
ID: Ephedra25_contig00013607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00013607 (3207 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006826237.1| hypothetical protein AMTR_s00132p00113370 [A... 65 2e-07 >ref|XP_006826237.1| hypothetical protein AMTR_s00132p00113370 [Amborella trichopoda] gi|548830481|gb|ERM93474.1| hypothetical protein AMTR_s00132p00113370 [Amborella trichopoda] Length = 503 Score = 65.1 bits (157), Expect = 2e-07 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -1 Query: 1497 KTGSVGCVLIGPLSSERKLDTGFGLHGNSKTVSILGSMESSHYYPENNLDIAR 1339 K+ SVGC S RK D FGLHG +T S+L SMESSHYY ENNLD AR Sbjct: 121 KSCSVGCTFANDRLSNRKPDAAFGLHGEPETASVLRSMESSHYYSENNLDHAR 173