BLASTX nr result
ID: Ephedra25_contig00013396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00013396 (588 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE77054.1| unknown [Picea sitchensis] 56 6e-06 ref|XP_002514855.1| Tyrosine-protein phosphatase SIW14, putative... 56 6e-06 ref|XP_006858403.1| hypothetical protein AMTR_s00071p00032040 [A... 56 8e-06 >gb|ADE77054.1| unknown [Picea sitchensis] Length = 194 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -2 Query: 368 YLCLEPYPEANQAFLRVHNIRLYQFGIEGRK 276 YLC EPYPEAN FLR HNI+L+QFGIEG K Sbjct: 58 YLCPEPYPEANTEFLRAHNIQLFQFGIEGHK 88 >ref|XP_002514855.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis] gi|223545906|gb|EEF47409.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis] Length = 200 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 368 YLCLEPYPEANQAFLRVHNIRLYQFGIEGR 279 YLCLEPYPE N FLR HNI+L+QFGIEG+ Sbjct: 52 YLCLEPYPEENMEFLRAHNIQLFQFGIEGK 81 >ref|XP_006858403.1| hypothetical protein AMTR_s00071p00032040 [Amborella trichopoda] gi|548862512|gb|ERN19870.1| hypothetical protein AMTR_s00071p00032040 [Amborella trichopoda] Length = 160 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -2 Query: 368 YLCLEPYPEANQAFLRVHNIRLYQFGIEGRK 276 YLC EPYPEANQAFL H I+L+QFGIEG K Sbjct: 45 YLCPEPYPEANQAFLESHGIKLFQFGIEGHK 75