BLASTX nr result
ID: Ephedra25_contig00012334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00012334 (548 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELQ73862.1| Ubiquitin/40S ribosomal protein S27a fusion [Trac... 59 8e-07 ref|XP_006900562.1| PREDICTED: polyubiquitin-C-like [Elephantulu... 59 1e-06 ref|XP_006158522.1| PREDICTED: ubiquitin-40S ribosomal protein S... 59 1e-06 ref|XP_006082981.1| PREDICTED: ubiquitin-40S ribosomal protein S... 59 1e-06 ref|NP_001174456.1| Os05g0457400 [Oryza sativa Japonica Group] g... 59 1e-06 gb|ELA47544.1| ubiquitin-40S ribosomal protein S27a [Vavraia cul... 58 2e-06 ref|XP_006729877.1| PREDICTED: ubiquitin-40S ribosomal protein S... 57 2e-06 ref|XP_002763251.1| PREDICTED: ubiquitin-40S ribosomal protein S... 57 2e-06 tpg|DAA62782.1| TPA: hypothetical protein ZEAMMB73_295026 [Zea m... 57 3e-06 ref|XP_006860312.1| PREDICTED: polyubiquitin-B-like [Chrysochlor... 57 4e-06 gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris] 57 4e-06 ref|XP_004956641.1| PREDICTED: ubiquitin-60S ribosomal protein L... 57 4e-06 ref|XP_004956640.1| PREDICTED: ubiquitin-60S ribosomal protein L... 57 4e-06 ref|XP_001770630.1| predicted protein [Physcomitrella patens] gi... 57 4e-06 ref|XP_002460099.1| hypothetical protein SORBIDRAFT_02g022750 [S... 57 4e-06 ref|XP_001770725.1| predicted protein [Physcomitrella patens] gi... 57 4e-06 ref|XP_004982762.1| PREDICTED: ubiquitin-40S ribosomal protein S... 56 5e-06 ref|XP_003563399.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquiti... 56 5e-06 tpg|DAA26453.1| TPA: ubiquitin and ribosomal protein S27a-like [... 56 5e-06 ref|XP_005678981.1| PREDICTED: ubiquitin-40S ribosomal protein S... 56 6e-06 >gb|ELQ73862.1| Ubiquitin/40S ribosomal protein S27a fusion [Trachipleistophora hominis] Length = 150 Score = 58.9 bits (141), Expect = 8e-07 Identities = 40/95 (42%), Positives = 51/95 (53%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKIV*FPNRRRSSYRNGKVWSFKY 180 KIQDKEG PPDQ LIFA KQLED TL+DY I K+S + R + KV++ Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGKKKKKKVYTTPK 88 Query: 181 FQKPSFSPRRYVASMSS*QVLIKLKPKKSKNISIL 285 +KP + V VL + KS N+S+L Sbjct: 89 KEKPKRIDTKDV-------VLTQFSVDKSGNVSVL 116 >ref|XP_006900562.1| PREDICTED: polyubiquitin-C-like [Elephantulus edwardii] Length = 153 Score = 58.5 bits (140), Expect = 1e-06 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKIV*FPNRR 138 KIQDKEG PPDQ LIFA KQLED CTL+DY I K+S + P R Sbjct: 29 KIQDKEGVPPDQQRLIFAGKQLEDGCTLSDYNIQKESTLHLVPRLR 74 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFARKQLED TL+DY I K+S + Sbjct: 105 KIQDKEGIPPDQQRLIFARKQLEDGRTLSDYNIQKESTL 143 >ref|XP_006158522.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Tupaia chinensis] Length = 257 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDS 111 KIQDKEG PPDQ LIFA KQLED CTL+DY I KDS Sbjct: 131 KIQDKEGIPPDQQRLIFAGKQLEDGCTLSDYNIQKDS 167 >ref|XP_006082981.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Myotis lucifugus] Length = 155 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLED CTL+DY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFADKQLEDRCTLSDYNIQKESTV 67 >ref|NP_001174456.1| Os05g0457400 [Oryza sativa Japonica Group] gi|222631836|gb|EEE63968.1| hypothetical protein OsJ_18793 [Oryza sativa Japonica Group] gi|255676421|dbj|BAH93184.1| Os05g0457400 [Oryza sativa Japonica Group] Length = 99 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLED CTLADY I K+S + Sbjct: 45 KIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKESTL 83 >gb|ELA47544.1| ubiquitin-40S ribosomal protein S27a [Vavraia culicis subsp. floridensis] Length = 150 Score = 57.8 bits (138), Expect = 2e-06 Identities = 39/95 (41%), Positives = 51/95 (53%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKIV*FPNRRRSSYRNGKVWSFKY 180 KIQDKEG PPDQ LIFA KQLED TL+DY I K+S + R + KV++ Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGKKKKKKVYTTPK 88 Query: 181 FQKPSFSPRRYVASMSS*QVLIKLKPKKSKNISIL 285 +KP + V VL + K+ N+S+L Sbjct: 89 KEKPKRIDTKDV-------VLTQFSVDKNGNVSVL 116 >ref|XP_006729877.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Leptonychotes weddellii] Length = 156 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLED CTL+DY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDGCTLSDYNIQKESTL 67 >ref|XP_002763251.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Callithrix jacchus] Length = 156 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLED CTL+DY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDGCTLSDYNIQKESTL 67 >tpg|DAA62782.1| TPA: hypothetical protein ZEAMMB73_295026 [Zea mays] Length = 141 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLED+ TLADY I KDS + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDDRTLADYSIQKDSTL 67 >ref|XP_006860312.1| PREDICTED: polyubiquitin-B-like [Chrysochloris asiatica] Length = 152 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLED CTL DY I K+S + Sbjct: 104 KIQDKEGIPPDQQRLIFAGKQLEDGCTLPDYNIQKESTL 142 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIF KQLED CTL+DY I K+S + Sbjct: 28 KIQDKEGIPPDQQRLIFVGKQLEDGCTLSDYNIQKESTL 66 >gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris] Length = 229 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KD 108 KIQDKEG PPDQ LIFA KQLED CTLADY I K+ Sbjct: 181 KIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKE 216 >ref|XP_004956641.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like isoform X2 [Setaria italica] Length = 140 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLEDE TLADY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTL 67 >ref|XP_004956640.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like isoform X1 [Setaria italica] Length = 218 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLEDE TLADY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTL 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLEDE TLADY I K+S + Sbjct: 105 KIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTL 143 >ref|XP_001770630.1| predicted protein [Physcomitrella patens] gi|81230136|dbj|BAE48267.1| putative polyubiquitin [Physcomitrella patens] gi|81230138|dbj|BAE48268.1| putative polyubiquitin [Physcomitrella patens] gi|162678151|gb|EDQ64613.1| predicted protein [Physcomitrella patens] Length = 153 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLEDE TLADY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTL 67 >ref|XP_002460099.1| hypothetical protein SORBIDRAFT_02g022750 [Sorghum bicolor] gi|241923476|gb|EER96620.1| hypothetical protein SORBIDRAFT_02g022750 [Sorghum bicolor] Length = 139 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLEDE TLADY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTL 67 >ref|XP_001770725.1| predicted protein [Physcomitrella patens] gi|162677943|gb|EDQ64407.1| predicted protein [Physcomitrella patens] Length = 153 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLEDE TLADY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTL 67 >ref|XP_004982762.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Setaria italica] Length = 162 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 K+QDKEG PPDQ LIFA KQLEDE TLADY I K+S + Sbjct: 29 KVQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTL 67 >ref|XP_003563399.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-C-like [Brachypodium distachyon] Length = 535 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEGTPPDQ LIFA KQLED TLADY I K+S + Sbjct: 487 KIQDKEGTPPDQQQLIFAGKQLEDGRTLADYNIQKESTL 525 >tpg|DAA26453.1| TPA: ubiquitin and ribosomal protein S27a-like [Bos taurus] Length = 156 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIFA KQLED CTL+DY + K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFAGKQLEDGCTLSDYNMQKESTL 67 >ref|XP_005678981.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Capra hircus] Length = 106 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 1 KIQDKEGTPPDQ*GLIFARKQLEDECTLADYKI*KDSKI 117 KIQDKEG PPDQ LIF KQLED CTL+DY I K+S + Sbjct: 29 KIQDKEGIPPDQQRLIFVGKQLEDGCTLSDYNIQKESTL 67