BLASTX nr result
ID: Ephedra25_contig00012187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00012187 (586 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE76423.1| unknown [Picea sitchensis] 85 1e-14 ref|XP_006855633.1| hypothetical protein AMTR_s00044p00098420 [A... 75 1e-11 ref|XP_006359151.1| PREDICTED: callose synthase 2-like isoform X... 75 1e-11 emb|CAZ15551.1| 1,3-beta-glucan synthase [Malus domestica] 75 2e-11 ref|XP_002528124.1| transferase, transferring glycosyl groups, p... 75 2e-11 gb|EXB29008.1| Callose synthase 3 [Morus notabilis] 74 2e-11 dbj|BAC42023.1| putative glucan synthase [Arabidopsis thaliana] 74 2e-11 ref|XP_006445915.1| hypothetical protein CICLE_v10014015mg [Citr... 74 2e-11 ref|XP_006410331.1| hypothetical protein EUTSA_v10016125mg [Eutr... 74 2e-11 gb|EPS70715.1| hypothetical protein M569_04038, partial [Genlise... 74 2e-11 gb|EPS65323.1| hypothetical protein M569_09455, partial [Genlise... 74 2e-11 gb|EMJ09513.1| hypothetical protein PRUPE_ppa003008mg [Prunus pe... 74 2e-11 gb|AAK37413.1|AF237733_1 callose synthase 1 catalytic subunit [A... 74 2e-11 gb|AAD30609.1|AC007153_1 Highly similar to putative callose synt... 74 2e-11 gb|AAF79729.1|AC005106_10 T25N20.22 [Arabidopsis thaliana] 74 2e-11 ref|NP_563743.2| callose synthase 1 [Arabidopsis thaliana] gi|18... 74 2e-11 ref|NP_001184913.1| callose synthase 1 [Arabidopsis thaliana] gi... 74 2e-11 ref|NP_850178.2| glucan synthase-like 3 [Arabidopsis thaliana] g... 74 2e-11 ref|XP_002892299.1| predicted protein [Arabidopsis lyrata subsp.... 74 2e-11 ref|XP_002879356.1| hypothetical protein ARALYDRAFT_482124 [Arab... 74 2e-11 >gb|ADE76423.1| unknown [Picea sitchensis] Length = 91 Score = 85.1 bits (209), Expect = 1e-14 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSS ++E Sbjct: 49 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSKSKE 91 >ref|XP_006855633.1| hypothetical protein AMTR_s00044p00098420 [Amborella trichopoda] gi|548859420|gb|ERN17100.1| hypothetical protein AMTR_s00044p00098420 [Amborella trichopoda] Length = 1941 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G+KKD SS +E Sbjct: 1899 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQKKDRSSDNKE 1941 >ref|XP_006359151.1| PREDICTED: callose synthase 2-like isoform X1 [Solanum tuberosum] gi|565386710|ref|XP_006359152.1| PREDICTED: callose synthase 2-like isoform X2 [Solanum tuberosum] gi|565386712|ref|XP_006359153.1| PREDICTED: callose synthase 2-like isoform X3 [Solanum tuberosum] gi|565386714|ref|XP_006359154.1| PREDICTED: callose synthase 2-like isoform X4 [Solanum tuberosum] Length = 1939 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G KKD SS+ +E Sbjct: 1897 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGPKKDRSSSNKE 1939 >emb|CAZ15551.1| 1,3-beta-glucan synthase [Malus domestica] Length = 392 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS ++E Sbjct: 350 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRSKE 392 >ref|XP_002528124.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223532463|gb|EEF34254.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1974 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS ++E Sbjct: 1913 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRSKE 1955 >gb|EXB29008.1| Callose synthase 3 [Morus notabilis] Length = 1951 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1909 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1951 >dbj|BAC42023.1| putative glucan synthase [Arabidopsis thaliana] Length = 735 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 693 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 735 >ref|XP_006445915.1| hypothetical protein CICLE_v10014015mg [Citrus clementina] gi|568879436|ref|XP_006492664.1| PREDICTED: callose synthase 3-like [Citrus sinensis] gi|557548526|gb|ESR59155.1| hypothetical protein CICLE_v10014015mg [Citrus clementina] Length = 1946 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1904 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1946 >ref|XP_006410331.1| hypothetical protein EUTSA_v10016125mg [Eutrema salsugineum] gi|557111500|gb|ESQ51784.1| hypothetical protein EUTSA_v10016125mg [Eutrema salsugineum] Length = 1950 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1908 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 >gb|EPS70715.1| hypothetical protein M569_04038, partial [Genlisea aurea] Length = 1941 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G +KD SS ++E Sbjct: 1899 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRSKE 1941 >gb|EPS65323.1| hypothetical protein M569_09455, partial [Genlisea aurea] Length = 780 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G KKD SS+ +E Sbjct: 738 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGPKKDRSSSHKE 780 >gb|EMJ09513.1| hypothetical protein PRUPE_ppa003008mg [Prunus persica] Length = 612 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 570 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 612 >gb|AAK37413.1|AF237733_1 callose synthase 1 catalytic subunit [Arabidopsis thaliana] Length = 1950 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1908 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 >gb|AAD30609.1|AC007153_1 Highly similar to putative callose synthase catalytic subunit [Arabidopsis thaliana] Length = 1878 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1836 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1878 >gb|AAF79729.1|AC005106_10 T25N20.22 [Arabidopsis thaliana] Length = 901 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 859 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 901 >ref|NP_563743.2| callose synthase 1 [Arabidopsis thaliana] gi|189081843|sp|Q9AUE0.2|CALS1_ARATH RecName: Full=Callose synthase 1; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 6 gi|332189734|gb|AEE27855.1| callose synthase 1 [Arabidopsis thaliana] Length = 1950 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1908 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 >ref|NP_001184913.1| callose synthase 1 [Arabidopsis thaliana] gi|332189735|gb|AEE27856.1| callose synthase 1 [Arabidopsis thaliana] Length = 1909 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1867 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1909 >ref|NP_850178.2| glucan synthase-like 3 [Arabidopsis thaliana] gi|334184626|ref|NP_001189653.1| glucan synthase-like 3 [Arabidopsis thaliana] gi|357529553|sp|Q9SL03.3|CALS2_ARATH RecName: Full=Callose synthase 2; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 3 gi|330253518|gb|AEC08612.1| glucan synthase-like 3 [Arabidopsis thaliana] gi|330253519|gb|AEC08613.1| glucan synthase-like 3 [Arabidopsis thaliana] Length = 1950 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1908 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950 >ref|XP_002892299.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297338141|gb|EFH68558.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 1955 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1913 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1955 >ref|XP_002879356.1| hypothetical protein ARALYDRAFT_482124 [Arabidopsis lyrata subsp. lyrata] gi|297325195|gb|EFH55615.1| hypothetical protein ARALYDRAFT_482124 [Arabidopsis lyrata subsp. lyrata] Length = 1936 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 1 LAWFPFVSEFQTRLLFNQAFSRGLQISRILAGRKKDWSSTTRE 129 LAWFPFVSEFQTR+LFNQAFSRGLQISRIL G++KD SS +E Sbjct: 1894 LAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1936