BLASTX nr result
ID: Ephedra25_contig00012167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00012167 (508 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_191902.1| uncharacterized protein [Arabidopsis thaliana] ... 55 1e-05 >ref|NP_191902.1| uncharacterized protein [Arabidopsis thaliana] gi|7573326|emb|CAB87796.1| putative protein [Arabidopsis thaliana] gi|190016004|gb|ACE62890.1| At3g63430 [Arabidopsis thaliana] gi|332646960|gb|AEE80481.1| uncharacterized protein AT3G63430 [Arabidopsis thaliana] Length = 540 Score = 55.1 bits (131), Expect = 1e-05 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 1/91 (1%) Frame = +3 Query: 30 DQIMKQVISEFQRVKGFNINSNKADDDMCNSLLKLIERDLTRDGWKKTIEVEQESVVNDV 209 D M+ + SEFQ+++ + S+ +DD+ + ++ RDL+ D W+ +VE V DV Sbjct: 453 DNKMQVIWSEFQKIR--DKKSSTEEDDLVGYVCGVLGRDLSEDRWRD-FQVEMSEAVLDV 509 Query: 210 ERLVFKELMDEFISDVMFFSYR-AHRRRLFF 299 ERL+FK+L+ E I + F + + RRRL F Sbjct: 510 ERLIFKDLIGETIRQLAFLNRSDSLRRRLLF 540