BLASTX nr result
ID: Ephedra25_contig00011516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00011516 (778 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844767.1| hypothetical protein AMTR_s00016p00258280 [A... 58 3e-06 gb|EPS66258.1| hypothetical protein M569_08518 [Genlisea aurea] 58 4e-06 ref|XP_004171986.1| PREDICTED: pentatricopeptide repeat-containi... 57 9e-06 ref|XP_002511099.1| pentatricopeptide repeat-containing protein,... 57 9e-06 >ref|XP_006844767.1| hypothetical protein AMTR_s00016p00258280 [Amborella trichopoda] gi|548847238|gb|ERN06442.1| hypothetical protein AMTR_s00016p00258280 [Amborella trichopoda] Length = 696 Score = 58.2 bits (139), Expect = 3e-06 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 1/103 (0%) Frame = -1 Query: 775 RGLVASILTRD-LVLGHCLSGDVCGALHMFRAFIDMGLKPEKETFEILVEGLSVDGLERD 599 RGLV I + D +V G+C G+ A+ M + ++P + TF ++E LS+ D Sbjct: 592 RGLVPMIWSHDDIVKGYCDQGNCVEAMAMLEKMLAGKMRPREYTFNRVIECLSLTDEVDD 651 Query: 598 ALWVLSRMFEYGHKPSESIFGSLVFRFCGEDAASAGTSFENLL 470 AL VL+ MFE G + + SLV R C A A TS E ++ Sbjct: 652 ALLVLNLMFEMGFRLQLPVSNSLVSRLCQNTANDAETSLEEIM 694 >gb|EPS66258.1| hypothetical protein M569_08518 [Genlisea aurea] Length = 610 Score = 57.8 bits (138), Expect = 4e-06 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 1/84 (1%) Frame = -1 Query: 775 RGLVASILT-RDLVLGHCLSGDVCGALHMFRAFIDMGLKPEKETFEILVEGLSVDGLERD 599 RGL+ + T L+ G C+ G A+++FR + G+ P T+ L++GLS DG E + Sbjct: 521 RGLIPDVFTYTSLIHGECIVGKTDNAVNLFREMQEEGIPPSDVTYTALIKGLSKDGREEE 580 Query: 598 ALWVLSRMFEYGHKPSESIFGSLV 527 A + M E G P + ++ SLV Sbjct: 581 AFRLYEEMTEAGFMPGDIVYSSLV 604 >ref|XP_004171986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cucumis sativus] Length = 539 Score = 56.6 bits (135), Expect = 9e-06 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 1/89 (1%) Frame = -1 Query: 778 QRGLVASILTRDLVLG-HCLSGDVCGALHMFRAFIDMGLKPEKETFEILVEGLSVDGLER 602 +RG A+ L +G HC G V A + + +MGLKP ETF +L+EG ++ G Sbjct: 327 ERGFQANSFIYTLFIGVHCRGGKVEEAHCLMQEMENMGLKPYPETFNLLIEGCAISGHSE 386 Query: 601 DALWVLSRMFEYGHKPSESIFGSLVFRFC 515 + L + +M E G PS S+F + + C Sbjct: 387 EILSMCEKMLERGFLPSCSVFNVAIAKIC 415 >ref|XP_002511099.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550214|gb|EEF51701.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1151 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/83 (31%), Positives = 45/83 (54%) Frame = -1 Query: 757 ILTRDLVLGHCLSGDVCGALHMFRAFIDMGLKPEKETFEILVEGLSVDGLERDALWVLSR 578 ++ DL+ G+C G+ A FR +D G+ P+ +T +L+ GLS +G ++A+ V S Sbjct: 583 VICTDLIDGYCKDGNTTKAFAKFRCMLDQGVLPDVQTHSVLIHGLSKNGKLQEAMGVFSE 642 Query: 577 MFEYGHKPSESIFGSLVFRFCGE 509 + + G P + SL+ C E Sbjct: 643 LLDKGLVPDVFTYTSLISNLCKE 665