BLASTX nr result
ID: Ephedra25_contig00009657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00009657 (574 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGM34023.1| class III homeodomain leucine zipper protein 33 [... 201 1e-49 gb|ABD90528.1| class III homeodomain-leucine zipper [Pseudotsuga... 199 4e-49 gb|ABG73246.1| class III HD-Zip protein HDZ32 [Pinus taeda] 197 2e-48 gb|ABD75310.1| class III homeodomain-leucine zipper protein C3HD... 195 6e-48 gb|ABG73247.1| class III HD-Zip protein HDZ33 [Pinus taeda] 194 1e-47 gb|ABD75312.1| class III homeodomain-leucine zipper protein C3HD... 194 2e-47 gb|ABG73251.1| class III HD-Zip protein HDZ32 [Ginkgo biloba] 193 2e-47 gb|ABD75307.1| class III homeodomain-leucine zipper protein C3HD... 193 2e-47 gb|ADV04324.1| class III homeodomain leucine zipper protein [Pic... 192 4e-47 gb|ABG73252.1| class III HD-Zip protein HDZ33 [Ginkgo biloba] 189 3e-46 gb|ADV04323.1| class III homeodomain leucine zipper protein [Pic... 189 6e-46 gb|ABD75308.1| class III homeodomain-leucine zipper protein C3HD... 188 1e-45 gb|AGM34022.1| class III homeodomain leucine zipper protein 32 [... 187 1e-45 gb|ABD75306.1| class III homeodomain-leucine zipper protein C3HD... 187 2e-45 gb|ADV04322.1| class III homeodomain leucine zipper protein [Pic... 186 3e-45 gb|ADE76969.1| unknown [Picea sitchensis] 186 5e-45 gb|ABB93495.1| homeodomain-leucine zipper trancription factor HB... 186 5e-45 gb|ABB94031.1| homeodomain-leucine zipper trancription factor HB... 186 5e-45 gb|ABB93496.1| homeodomain-leucine zipper trancription factor HB... 186 5e-45 gb|ABD75309.1| class III homeodomain-leucine zipper protein C3HD... 186 5e-45 >gb|AGM34023.1| class III homeodomain leucine zipper protein 33 [Larix kaempferi] Length = 840 Score = 201 bits (510), Expect = 1e-49 Identities = 122/203 (60%), Positives = 143/203 (70%), Gaps = 13/203 (6%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*ECN--------W*L 149 SQVILPL TVE+EE VIK+E HGLT+EEALLSKDMFLLQ CN + Sbjct: 512 SQVILPLAHTVEHEEFLEVIKLEGHGLTHEEALLSKDMFLLQL----CNGIDEHAAGFCA 567 Query: 150 FLTFVAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDN 329 L F APIDA+F+DDAPLLPSGF +I +ESG D + PNRTLDLAS+LE+G G R D Sbjct: 568 QLVF-APIDASFADDAPLLPSGFRVIPLESGSDASPPNRTLDLASALEVGSAGARASGDR 626 Query: 330 AGNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSP--QHSSLGM 503 +P NLRSVLTIAFQFTYQ H++++VAAMA QYV IASVQR+++AL+P Q LG Sbjct: 627 GDSPYNLRSVLTIAFQFTYQTHVRDNVAAMARQYVRHVIASVQRVSIALAPSLQSPHLGP 686 Query: 504 RSLSGALEAGTLAH*IRQSYRIH 572 R G EA TL I QSYR+H Sbjct: 687 RLPPGTPEALTLTRWICQSYRMH 709 >gb|ABD90528.1| class III homeodomain-leucine zipper [Pseudotsuga menziesii] Length = 840 Score = 199 bits (506), Expect = 4e-49 Identities = 120/199 (60%), Positives = 142/199 (71%), Gaps = 9/199 (4%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*----ECNW*LFLTF 161 SQVILPL TVE+EE VIK+E HGLT+EEALLSKDMFLLQ + L F Sbjct: 512 SQVILPLAHTVEHEEFLEVIKLEGHGLTHEEALLSKDMFLLQLCSGIDEQAAGFCAQLAF 571 Query: 162 VAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNAGNP 341 APIDA+F+DDAPLLPSGF +I +ESG DT+ PNRTLDLAS+LE+G G R D +P Sbjct: 572 -APIDASFADDAPLLPSGFRVIPLESGSDTSPPNRTLDLASALEVGSAGARASGDCGDSP 630 Query: 342 NNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSP--QHSSLGMRSLS 515 NLRSVLTIAFQFTYQ H++++VA+MA QYV IASVQR+++AL+P Q LG R Sbjct: 631 YNLRSVLTIAFQFTYQNHVRDNVASMARQYVRHVIASVQRVSVALAPSLQSPHLGPRPPP 690 Query: 516 GALEAGTLAH*IRQSYRIH 572 G EA TL I QSYR+H Sbjct: 691 GTPEALTLTRWICQSYRMH 709 >gb|ABG73246.1| class III HD-Zip protein HDZ32 [Pinus taeda] Length = 844 Score = 197 bits (501), Expect = 2e-48 Identities = 119/202 (58%), Positives = 141/202 (69%), Gaps = 13/202 (6%) Frame = +3 Query: 6 QVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQW--------IG*ECNW*LF 152 QVILPL TVE+EE VIK+E HGLT EEALLS+DMFLLQ +G C +F Sbjct: 517 QVILPLAHTVEHEEFLEVIKLENHGLTQEEALLSRDMFLLQLCSGLDENAVG-ACAELVF 575 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNA 332 APIDA+ +D +PLLPSGF +I ++SG D +SPNRTLDLASSLEIG G R D Sbjct: 576 ----APIDASLADSSPLLPSGFRVIPLDSGMDGSSPNRTLDLASSLEIGSAGARTSVDYG 631 Query: 333 GNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQH--SSLGMR 506 GN NLRSVLTIAFQFT++ H++E+VA+MA QYV G +ASVQR+AMAL+P S LG R Sbjct: 632 GNSGNLRSVLTIAFQFTFENHLRENVASMARQYVRGVVASVQRVAMALAPSRLGSHLGPR 691 Query: 507 SLSGALEAGTLAH*IRQSYRIH 572 G EA TLA + QSYR H Sbjct: 692 LPPGTPEALTLARWVCQSYRFH 713 >gb|ABD75310.1| class III homeodomain-leucine zipper protein C3HDZ2 [Pseudotsuga menziesii] Length = 839 Score = 195 bits (496), Expect = 6e-48 Identities = 120/199 (60%), Positives = 142/199 (71%), Gaps = 9/199 (4%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*----ECNW*LFLTF 161 SQVILPL TVE+EE VIK+E HGLT+EEALLSKDMFLLQ + L F Sbjct: 512 SQVILPLAHTVEHEEFLEVIKLEGHGLTHEEALLSKDMFLLQLCSGIDEQAAGFCAQLAF 571 Query: 162 VAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNAGNP 341 APIDA+F+DDAPLLPSGF +I +ESG DT+ PNRTLDLAS+LE+G G R D G+ Sbjct: 572 -APIDASFADDAPLLPSGFRVIPLESGSDTSPPNRTLDLASALEVGSAGARASGD-CGDS 629 Query: 342 NNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSP--QHSSLGMRSLS 515 NLRSVLTIAFQFTYQ H++++VA+MA QYV IASVQR+++AL+P Q LG R Sbjct: 630 PNLRSVLTIAFQFTYQNHVRDNVASMARQYVRHVIASVQRVSVALAPSLQSPHLGPRPPP 689 Query: 516 GALEAGTLAH*IRQSYRIH 572 G EA TL I QSYR+H Sbjct: 690 GTPEALTLTRWICQSYRMH 708 >gb|ABG73247.1| class III HD-Zip protein HDZ33 [Pinus taeda] Length = 840 Score = 194 bits (493), Expect = 1e-47 Identities = 119/202 (58%), Positives = 140/202 (69%), Gaps = 12/202 (5%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*E-------CNW*LF 152 SQVILPL TVE+EE VIK+E HGLT+EEALLSKDMFLLQ C+ +F Sbjct: 512 SQVILPLAHTVEHEEFLEVIKLEGHGLTHEEALLSKDMFLLQLCSGIDEHAAGFCSQLVF 571 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNA 332 APIDA+F+DDAPLLPSGF +I +ESG D + PNRTLDLAS+LEIG G R D Sbjct: 572 ----APIDASFADDAPLLPSGFRVIPLESGSDVSPPNRTLDLASALEIGSAGTRASGDCG 627 Query: 333 GNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSS--LGMR 506 +P NLRSVLTIAFQFTYQ ++++ VAAM QYV IASVQR+A+AL+P S +G R Sbjct: 628 DSPCNLRSVLTIAFQFTYQNNVRDSVAAMTRQYVRNVIASVQRVAIALAPSQQSPHIGPR 687 Query: 507 SLSGALEAGTLAH*IRQSYRIH 572 G EA TL I QSYR+H Sbjct: 688 LPPGTPEALTLTRWIFQSYRMH 709 >gb|ABD75312.1| class III homeodomain-leucine zipper protein C3HDZ2 [Taxus globosa] Length = 843 Score = 194 bits (492), Expect = 2e-47 Identities = 117/202 (57%), Positives = 143/202 (70%), Gaps = 13/202 (6%) Frame = +3 Query: 6 QVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQW--------IG*ECNW*LF 152 QVILPL TVE+EE VIK+E +GLT EEALLS+DMFLLQ +G C +F Sbjct: 516 QVILPLAHTVEHEEFLEVIKLECNGLTQEEALLSRDMFLLQLCSGIDENAVG-ACAELVF 574 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNA 332 APIDA+ +D APLLPSGF +I ++SG D++SPNRTLDLAS+L++GP G R D Sbjct: 575 ----APIDASLTDSAPLLPSGFRVIPLDSGIDSSSPNRTLDLASALDVGPTGNRPAGDYG 630 Query: 333 GNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQH--SSLGMR 506 GN +N+RSVLTIAFQFTY+ H++E+VA+MA QYV +ASVQR+AMAL+P S LG R Sbjct: 631 GNSSNIRSVLTIAFQFTYENHLRENVASMARQYVRNVVASVQRVAMALAPSRLGSHLGPR 690 Query: 507 SLSGALEAGTLAH*IRQSYRIH 572 G EA TLA I QSYR H Sbjct: 691 PPPGTPEALTLARWICQSYRFH 712 >gb|ABG73251.1| class III HD-Zip protein HDZ32 [Ginkgo biloba] Length = 779 Score = 193 bits (491), Expect = 2e-47 Identities = 119/202 (58%), Positives = 142/202 (70%), Gaps = 13/202 (6%) Frame = +3 Query: 6 QVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQW--------IG*ECNW*LF 152 QVILPL TVE+EE VIK+E +GLT EEALLS++MFLLQ +G C +F Sbjct: 452 QVILPLAHTVEHEEFLEVIKLEGNGLTQEEALLSREMFLLQLCSGVDENAVG-ACAELVF 510 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNA 332 APIDA+F+D+APLLPSGF +I ++SG D +SPNRTLDLAS+LEIGP G R D Sbjct: 511 ----APIDASFADNAPLLPSGFRVIPLDSGVDGSSPNRTLDLASALEIGPAGTRVSGDYG 566 Query: 333 GNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQH--SSLGMR 506 GN NLRSVLTIAFQFTY+ H++E+VA+MA QYV +ASVQR+AMAL+P S LG R Sbjct: 567 GNSGNLRSVLTIAFQFTYEDHLRENVASMARQYVRSVVASVQRVAMALAPSRLSSHLGPR 626 Query: 507 SLSGALEAGTLAH*IRQSYRIH 572 G EA TLA I SYR H Sbjct: 627 PPPGTPEALTLARWICHSYRFH 648 >gb|ABD75307.1| class III homeodomain-leucine zipper protein C3HDZ2 [Ginkgo biloba] Length = 843 Score = 193 bits (491), Expect = 2e-47 Identities = 119/202 (58%), Positives = 142/202 (70%), Gaps = 13/202 (6%) Frame = +3 Query: 6 QVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQW--------IG*ECNW*LF 152 QVILPL TVE+EE VIK+E +GLT EEALLS++MFLLQ +G C +F Sbjct: 516 QVILPLAHTVEHEEFLEVIKLEGNGLTQEEALLSREMFLLQLCSGVDENAVG-ACAELVF 574 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNA 332 APIDA+F+D+APLLPSGF +I ++SG D +SPNRTLDLAS+LEIGP G R D Sbjct: 575 ----APIDASFADNAPLLPSGFRVIPLDSGVDGSSPNRTLDLASALEIGPAGTRVSGDYG 630 Query: 333 GNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQH--SSLGMR 506 GN NLRSVLTIAFQFTY+ H++E+VA+MA QYV +ASVQR+AMAL+P S LG R Sbjct: 631 GNSGNLRSVLTIAFQFTYENHLRENVASMARQYVRSVVASVQRVAMALAPSRLSSHLGPR 690 Query: 507 SLSGALEAGTLAH*IRQSYRIH 572 G EA TLA I SYR H Sbjct: 691 PPPGTPEALTLARWICHSYRFH 712 >gb|ADV04324.1| class III homeodomain leucine zipper protein [Picea glauca] Length = 845 Score = 192 bits (489), Expect = 4e-47 Identities = 117/202 (57%), Positives = 141/202 (69%), Gaps = 13/202 (6%) Frame = +3 Query: 6 QVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQW--------IG*ECNW*LF 152 QVILPL TVE+EE VIK+E +GLT EEALLS+DMFLLQ +G C +F Sbjct: 518 QVILPLAHTVEHEEFLEVIKLENNGLTQEEALLSRDMFLLQLCSGIDENAVG-ACAELVF 576 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNA 332 APIDA+ +D +PLLPSGF +I ++SG D +SPNRTLDLAS+LEIG G R D Sbjct: 577 ----APIDASLADSSPLLPSGFRVIPLDSGMDGSSPNRTLDLASALEIGSAGTRTSVDYG 632 Query: 333 GNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQH--SSLGMR 506 GN +NLRSVLTIAFQFT++ H++E+VA MA QYV G +ASVQR+AMAL+P S LG R Sbjct: 633 GNSSNLRSVLTIAFQFTFENHLRENVATMARQYVRGVVASVQRVAMALAPSRLGSHLGPR 692 Query: 507 SLSGALEAGTLAH*IRQSYRIH 572 G EA TLA + QSYR H Sbjct: 693 LPPGTPEALTLARWVCQSYRFH 714 >gb|ABG73252.1| class III HD-Zip protein HDZ33 [Ginkgo biloba] Length = 776 Score = 189 bits (481), Expect = 3e-46 Identities = 112/198 (56%), Positives = 138/198 (69%), Gaps = 8/198 (4%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQW---IG*ECNW*LFLTFV 164 SQVILPL T+E+EE VIK+E HGLT+EE +LS+DMFLLQ I Sbjct: 448 SQVILPLAHTMEHEEFLEVIKLEGHGLTHEETVLSRDMFLLQLCSGIDENAVGCCAQLVF 507 Query: 165 APIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNAGNPN 344 APIDA+F+DDAPLLPSGF +I ++SG D ++PNRTLDLAS+L++G G R D + Sbjct: 508 APIDASFADDAPLLPSGFRVIPLDSGTDGSTPNRTLDLASALDVGSAGTRTSGDYGSSTY 567 Query: 345 NLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSS--LGMRSLSG 518 N+RSVLTIAFQFTY+ H++++VAAMA QYV +ASVQR+AMAL+P S LG R G Sbjct: 568 NMRSVLTIAFQFTYETHLRDNVAAMARQYVRSVVASVQRVAMALAPSRQSTLLGPRPPPG 627 Query: 519 ALEAGTLAH*IRQSYRIH 572 EA TLA I QSYR H Sbjct: 628 TPEALTLAGWICQSYRFH 645 >gb|ADV04323.1| class III homeodomain leucine zipper protein [Picea glauca] Length = 836 Score = 189 bits (479), Expect = 6e-46 Identities = 117/197 (59%), Positives = 137/197 (69%), Gaps = 7/197 (3%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*----ECNW*LFLTF 161 SQVILPL TVE+EE VIK+E GLT+EEALLSKDMFLLQ + L F Sbjct: 512 SQVILPLAHTVEHEEFLEVIKLEGQGLTHEEALLSKDMFLLQLCSGIDEHAVGFCAQLVF 571 Query: 162 VAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNAGNP 341 APIDA+F+DDAPLLPSGF +I +ESG D + PNRTLDLAS+LE+G G R D +P Sbjct: 572 -APIDASFADDAPLLPSGFRVIPLESGSDASPPNRTLDLASALEVGSAGTRASGDCGDSP 630 Query: 342 NNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSSLGMRSLSGA 521 NLRSVLTIAFQFTYQ H+++ VAAMA QYV IASVQR+A+AL+P S G Sbjct: 631 YNLRSVLTIAFQFTYQNHVRDSVAAMARQYVRHVIASVQRVAIALAPSLQS--PHPPPGT 688 Query: 522 LEAGTLAH*IRQSYRIH 572 EA TLA I +SYR+H Sbjct: 689 PEALTLARWICESYRMH 705 >gb|ABD75308.1| class III homeodomain-leucine zipper protein C3HDZ3 [Ginkgo biloba] Length = 837 Score = 188 bits (477), Expect = 1e-45 Identities = 113/198 (57%), Positives = 139/198 (70%), Gaps = 8/198 (4%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQW---IG*ECNW*LFLTFV 164 SQVILPL T+E+EE VIK+E HGLT+EE +LS+DMFLLQ I Sbjct: 510 SQVILPLAHTMEHEEFLEVIKLEGHGLTHEETVLSRDMFLLQLCSGIDENAVGCCAQLVF 569 Query: 165 APIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNAGNPN 344 APIDA+F+DDAPLLPSGF +I ++SG D ++PNRTLDLAS+L++G G R D G+ Sbjct: 570 APIDASFADDAPLLPSGFRVIPLDSGTDGSTPNRTLDLASALDVGSAGTRTSGD-YGSST 628 Query: 345 NLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSS--LGMRSLSG 518 N+RSVLTIAFQFTY+ H++++VAAMA QYV +ASVQR+AMAL+P S LG R G Sbjct: 629 NMRSVLTIAFQFTYETHLRDNVAAMARQYVRSVVASVQRVAMALAPSRQSTLLGPRPPPG 688 Query: 519 ALEAGTLAH*IRQSYRIH 572 EA TLA I QSYR H Sbjct: 689 TPEALTLAGWICQSYRFH 706 >gb|AGM34022.1| class III homeodomain leucine zipper protein 32 [Larix kaempferi] Length = 845 Score = 187 bits (476), Expect = 1e-45 Identities = 112/202 (55%), Positives = 142/202 (70%), Gaps = 13/202 (6%) Frame = +3 Query: 6 QVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQW--------IG*ECNW*LF 152 QVILPL TVE+EE VIK+E +GLT E+ALLS+DMFLLQ +G C+ +F Sbjct: 518 QVILPLAHTVEHEEFLEVIKLENNGLTQEDALLSRDMFLLQLCSGIDENAVG-ACSELIF 576 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQDTASPNRTLDLASSLEIGPVGGRGGTDNA 332 APIDA+ +D++PLLPSGF ++ +SG D +SPNRTLDLAS+LEIG G R D Sbjct: 577 ----APIDASLADNSPLLPSGFRVVPSDSGMDGSSPNRTLDLASALEIGSAGTRTSVDYG 632 Query: 333 GNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQH--SSLGMR 506 GN +N RSVLTIAFQFT++ H++E+VA+MA QY+ G +ASVQR++MAL+P S LG R Sbjct: 633 GNNSNFRSVLTIAFQFTFENHIRENVASMARQYLRGVVASVQRVSMALAPSRMGSHLGPR 692 Query: 507 SLSGALEAGTLAH*IRQSYRIH 572 G EA TLA + QSYR H Sbjct: 693 LPPGTPEALTLARWVCQSYRFH 714 >gb|ABD75306.1| class III homeodomain-leucine zipper protein C3HDZ1 [Ginkgo biloba] Length = 842 Score = 187 bits (474), Expect = 2e-45 Identities = 116/203 (57%), Positives = 139/203 (68%), Gaps = 13/203 (6%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*-------ECNW*LF 152 SQVILPL TVE+EE VIK+E HGLT EEA+LS+DMFLLQ C +F Sbjct: 513 SQVILPLAHTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAQLVF 572 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQD-TASPNRTLDLASSLEIGPVGGRGGTDN 329 APID +F+DDAPLLPSGF +I ++S D T+ PNRTLDLAS+LE+G G R D+ Sbjct: 573 ----APIDESFADDAPLLPSGFRVIPLDSRTDGTSGPNRTLDLASALEVGSAGTRTSGDS 628 Query: 330 AGNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQH--SSLGM 503 N NLRSVLTIAFQFTY+ H++E+VA+MA QYV +ASVQR+AMAL+P S +G Sbjct: 629 GANSFNLRSVLTIAFQFTYENHLRENVASMARQYVRSVVASVQRVAMALAPSRLSSHVGP 688 Query: 504 RSLSGALEAGTLAH*IRQSYRIH 572 R G EA TLA I QSYR H Sbjct: 689 RLPPGTPEALTLARWICQSYRFH 711 >gb|ADV04322.1| class III homeodomain leucine zipper protein [Picea glauca] Length = 842 Score = 186 bits (473), Expect = 3e-45 Identities = 117/203 (57%), Positives = 140/203 (68%), Gaps = 13/203 (6%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*-------ECNW*LF 152 SQVILPL TVE+EE VIK+E HGLT EEA+LS+DMFLLQ C +F Sbjct: 514 SQVILPLAHTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVF 573 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQD-TASPNRTLDLASSLEIGPVGGRGGTDN 329 APID +F+DDAPLLPSGF +I +ES D + PNRTLDLAS+LE+G G R D+ Sbjct: 574 ----APIDESFADDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVGSAGARTSGDS 629 Query: 330 AGNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSS--LGM 503 N +NLRSVLTIAFQFTY+ H++E+VAAMA QYV +ASVQR+AMAL+P S +G Sbjct: 630 GAN-SNLRSVLTIAFQFTYESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGP 688 Query: 504 RSLSGALEAGTLAH*IRQSYRIH 572 R G EA TLA I QSYR+H Sbjct: 689 RPPPGTPEALTLARWICQSYRLH 711 >gb|ADE76969.1| unknown [Picea sitchensis] Length = 353 Score = 186 bits (471), Expect = 5e-45 Identities = 117/203 (57%), Positives = 140/203 (68%), Gaps = 13/203 (6%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*-------ECNW*LF 152 SQVILPL TVE+EE VIK+E HGLT EEA+LS+DMFLLQ C +F Sbjct: 53 SQVILPLAHTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVF 112 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQD-TASPNRTLDLASSLEIGPVGGRGGTDN 329 APID +F+DDAPLLPSGF +I +ES D + PNRTLDLAS+LE+G G R D+ Sbjct: 113 ----APIDESFADDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVGSAGTRTSGDS 168 Query: 330 AGNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSS--LGM 503 N +NLRSVLTIAFQFTY+ H++E+VAAMA QYV +ASVQR+AMAL+P S +G Sbjct: 169 GAN-SNLRSVLTIAFQFTYESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGP 227 Query: 504 RSLSGALEAGTLAH*IRQSYRIH 572 R G EA TLA I QSYR+H Sbjct: 228 RPPPGTPEALTLARWICQSYRLH 250 >gb|ABB93495.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908654|gb|ABB93497.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908656|gb|ABB93498.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908658|gb|ABB93499.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908660|gb|ABB93500.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908662|gb|ABB93501.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908664|gb|ABB93502.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908666|gb|ABB93503.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908668|gb|ABB93504.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908670|gb|ABB93505.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908672|gb|ABB93506.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908674|gb|ABB93507.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908676|gb|ABB93508.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908678|gb|ABB93509.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908680|gb|ABB93510.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908682|gb|ABB93511.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908684|gb|ABB93512.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908686|gb|ABB93513.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908688|gb|ABB93514.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908690|gb|ABB93515.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908692|gb|ABB93516.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908694|gb|ABB93517.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908696|gb|ABB93518.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908698|gb|ABB93519.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908700|gb|ABB93520.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908702|gb|ABB93521.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908704|gb|ABB93522.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908706|gb|ABB93523.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908708|gb|ABB93524.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908710|gb|ABB93525.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908712|gb|ABB93526.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908714|gb|ABB93527.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908716|gb|ABB93528.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908718|gb|ABB93529.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908720|gb|ABB93530.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908722|gb|ABB93531.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908724|gb|ABB93532.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908726|gb|ABB93533.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908728|gb|ABB93534.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908730|gb|ABB93535.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908732|gb|ABB93536.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908734|gb|ABB93537.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908736|gb|ABB93538.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908738|gb|ABB93539.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908740|gb|ABB93540.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908742|gb|ABB93541.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908744|gb|ABB93542.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908748|gb|ABB93544.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908750|gb|ABB93545.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908752|gb|ABB93546.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908754|gb|ABB93547.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908756|gb|ABB93548.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908760|gb|ABB93550.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908762|gb|ABB93551.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908764|gb|ABB93552.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908768|gb|ABB93554.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908770|gb|ABB93555.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908772|gb|ABB93556.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908774|gb|ABB93557.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908778|gb|ABB93559.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908780|gb|ABB93560.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908782|gb|ABB93561.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908784|gb|ABB93562.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908786|gb|ABB93563.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908788|gb|ABB93564.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908790|gb|ABB93565.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908794|gb|ABB93567.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908796|gb|ABB93568.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908798|gb|ABB93569.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908800|gb|ABB93570.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908802|gb|ABB93571.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908804|gb|ABB93572.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908806|gb|ABB93573.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908808|gb|ABB93574.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908810|gb|ABB93575.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908812|gb|ABB93576.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908816|gb|ABB93578.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908818|gb|ABB93579.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908820|gb|ABB93580.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908822|gb|ABB93581.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908826|gb|ABB93583.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908828|gb|ABB93584.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908830|gb|ABB93585.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908832|gb|ABB93586.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908834|gb|ABB93587.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908836|gb|ABB93588.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908838|gb|ABB93589.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908840|gb|ABB93590.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908844|gb|ABB93592.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82909691|gb|ABB94009.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909693|gb|ABB94010.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909695|gb|ABB94011.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909697|gb|ABB94012.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909699|gb|ABB94013.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909701|gb|ABB94014.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909703|gb|ABB94015.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909705|gb|ABB94016.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909707|gb|ABB94017.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909709|gb|ABB94018.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909711|gb|ABB94019.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909713|gb|ABB94020.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909715|gb|ABB94021.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909717|gb|ABB94022.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909719|gb|ABB94023.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909721|gb|ABB94024.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909723|gb|ABB94025.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909725|gb|ABB94026.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909727|gb|ABB94027.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909729|gb|ABB94028.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909731|gb|ABB94029.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909733|gb|ABB94030.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909737|gb|ABB94032.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909739|gb|ABB94033.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909741|gb|ABB94034.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909743|gb|ABB94035.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909745|gb|ABB94036.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909747|gb|ABB94037.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909749|gb|ABB94038.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909751|gb|ABB94039.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909753|gb|ABB94040.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909755|gb|ABB94041.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909757|gb|ABB94042.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909759|gb|ABB94043.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909761|gb|ABB94044.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909763|gb|ABB94045.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909765|gb|ABB94046.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909767|gb|ABB94047.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909769|gb|ABB94048.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909771|gb|ABB94049.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909773|gb|ABB94050.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909775|gb|ABB94051.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909777|gb|ABB94052.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909779|gb|ABB94053.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909781|gb|ABB94054.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909783|gb|ABB94055.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909785|gb|ABB94056.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909787|gb|ABB94057.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909789|gb|ABB94058.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909791|gb|ABB94059.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909793|gb|ABB94060.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909795|gb|ABB94061.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909797|gb|ABB94062.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909799|gb|ABB94063.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909801|gb|ABB94064.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909803|gb|ABB94065.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909805|gb|ABB94066.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909807|gb|ABB94067.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909809|gb|ABB94068.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909811|gb|ABB94069.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909813|gb|ABB94070.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909815|gb|ABB94071.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909817|gb|ABB94072.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909819|gb|ABB94073.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909821|gb|ABB94074.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909823|gb|ABB94075.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909825|gb|ABB94076.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909827|gb|ABB94077.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909829|gb|ABB94078.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909831|gb|ABB94079.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909833|gb|ABB94080.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909835|gb|ABB94081.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909837|gb|ABB94082.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909839|gb|ABB94083.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909841|gb|ABB94084.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909843|gb|ABB94085.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909845|gb|ABB94086.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909847|gb|ABB94087.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909849|gb|ABB94088.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909851|gb|ABB94089.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909853|gb|ABB94090.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909855|gb|ABB94091.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909857|gb|ABB94092.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909859|gb|ABB94093.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909861|gb|ABB94094.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909863|gb|ABB94095.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909865|gb|ABB94096.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909867|gb|ABB94097.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909869|gb|ABB94098.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909873|gb|ABB94100.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909875|gb|ABB94101.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909877|gb|ABB94102.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909879|gb|ABB94103.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909881|gb|ABB94104.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909883|gb|ABB94105.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909885|gb|ABB94106.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909887|gb|ABB94107.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909889|gb|ABB94108.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909891|gb|ABB94109.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909893|gb|ABB94110.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909895|gb|ABB94111.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909897|gb|ABB94112.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909899|gb|ABB94113.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909901|gb|ABB94114.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909903|gb|ABB94115.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909905|gb|ABB94116.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909907|gb|ABB94117.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909909|gb|ABB94118.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909911|gb|ABB94119.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909913|gb|ABB94120.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909915|gb|ABB94121.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909917|gb|ABB94122.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909919|gb|ABB94123.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909921|gb|ABB94124.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909923|gb|ABB94125.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909925|gb|ABB94126.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909927|gb|ABB94127.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909929|gb|ABB94128.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 186 bits (471), Expect = 5e-45 Identities = 117/203 (57%), Positives = 140/203 (68%), Gaps = 13/203 (6%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*-------ECNW*LF 152 SQVILPL TVE+EE VIK+E HGLT EEA+LS+DMFLLQ C +F Sbjct: 514 SQVILPLAHTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVF 573 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQD-TASPNRTLDLASSLEIGPVGGRGGTDN 329 APID +F+DDAPLLPSGF +I +ES D + PNRTLDLAS+LE+G G R D+ Sbjct: 574 ----APIDESFADDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVGSAGTRTSGDS 629 Query: 330 AGNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSS--LGM 503 N +NLRSVLTIAFQFTY+ H++E+VAAMA QYV +ASVQR+AMAL+P S +G Sbjct: 630 GAN-SNLRSVLTIAFQFTYESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGP 688 Query: 504 RSLSGALEAGTLAH*IRQSYRIH 572 R G EA TLA I QSYR+H Sbjct: 689 RPPPGTPEALTLARWICQSYRLH 711 >gb|ABB94031.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 186 bits (471), Expect = 5e-45 Identities = 117/203 (57%), Positives = 140/203 (68%), Gaps = 13/203 (6%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*-------ECNW*LF 152 SQVILPL TVE+EE VIK+E HGLT EEA+LS+DMFLLQ C +F Sbjct: 514 SQVILPLAHTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVF 573 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQD-TASPNRTLDLASSLEIGPVGGRGGTDN 329 APID +F+DDAPLLPSGF +I +ES D + PNRTLDLAS+LE+G G R D+ Sbjct: 574 ----APIDESFADDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVGSAGTRTSGDS 629 Query: 330 AGNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSS--LGM 503 N +NLRSVLTIAFQFTY+ H++E+VAAMA QYV +ASVQR+AMAL+P S +G Sbjct: 630 GAN-SNLRSVLTIAFQFTYESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGP 688 Query: 504 RSLSGALEAGTLAH*IRQSYRIH 572 R G EA TLA I QSYR+H Sbjct: 689 RPPPGTPEALTLARWICQSYRLH 711 >gb|ABB93496.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] Length = 842 Score = 186 bits (471), Expect = 5e-45 Identities = 117/203 (57%), Positives = 140/203 (68%), Gaps = 13/203 (6%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*-------ECNW*LF 152 SQVILPL TVE+EE VIK+E HGLT EEA+LS+DMFLLQ C +F Sbjct: 514 SQVILPLAHTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVF 573 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQD-TASPNRTLDLASSLEIGPVGGRGGTDN 329 APID +F+DDAPLLPSGF +I +ES D + PNRTLDLAS+LE+G G R D+ Sbjct: 574 ----APIDESFADDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVGSAGTRTSGDS 629 Query: 330 AGNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQHSS--LGM 503 N +NLRSVLTIAFQFTY+ H++E+VAAMA QYV +ASVQR+AMAL+P S +G Sbjct: 630 GAN-SNLRSVLTIAFQFTYESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGP 688 Query: 504 RSLSGALEAGTLAH*IRQSYRIH 572 R G EA TLA I QSYR+H Sbjct: 689 RPPPGTPEALTLARWICQSYRLH 711 >gb|ABD75309.1| class III homeodomain-leucine zipper protein C3HDZ1 [Pseudotsuga menziesii] Length = 842 Score = 186 bits (471), Expect = 5e-45 Identities = 118/203 (58%), Positives = 140/203 (68%), Gaps = 13/203 (6%) Frame = +3 Query: 3 SQVILPLVLTVENEE---VIKIERHGLTYEEALLSKDMFLLQWIG*-------ECNW*LF 152 SQVILPL TVE+EE VIK+E HGLT EEA+LS+DMFLLQ C +F Sbjct: 514 SQVILPLAHTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVF 573 Query: 153 LTFVAPIDATFSDDAPLLPSGFWIILMESGQD-TASPNRTLDLASSLEIGPVGGRGGTDN 329 APID +F+DDAPLLPSGF II +ES D + PNRTLDLAS+LE+G G R D+ Sbjct: 574 ----APIDESFADDAPLLPSGFRIIPLESRTDGSGGPNRTLDLASALEVGSAGTRTSGDS 629 Query: 330 AGNPNNLRSVLTIAFQFTYQCHMQEHVAAMASQYVCGAIASVQRLAMALSPQH--SSLGM 503 N +NLRSVLTIAFQFTY+ H++E+VAAMA QYV +ASVQR+AMAL+P S +G Sbjct: 630 GAN-SNLRSVLTIAFQFTYESHLRENVAAMARQYVRTVVASVQRVAMALAPSRLSSHVGP 688 Query: 504 RSLSGALEAGTLAH*IRQSYRIH 572 R G EA TLA I QSYR+H Sbjct: 689 RPPPGTPEALTLARWICQSYRLH 711