BLASTX nr result
ID: Ephedra25_contig00009029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00009029 (1225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301307.2| cytochrome P450 family protein [Populus tric... 60 2e-06 ref|XP_002301305.2| cytochrome P450 family protein [Populus tric... 58 7e-06 ref|XP_002301306.2| hypothetical protein POPTR_0002s15150g [Popu... 58 9e-06 >ref|XP_002301307.2| cytochrome P450 family protein [Populus trichocarpa] gi|550345063|gb|EEE80580.2| cytochrome P450 family protein [Populus trichocarpa] Length = 496 Score = 60.1 bits (144), Expect = 2e-06 Identities = 28/66 (42%), Positives = 38/66 (57%) Frame = +3 Query: 12 EFKDYLARVVDTVGSPNIVDYLPFLRALDPQRLLRDTEFYMKKCNGIIDSFIHNRVKFPH 191 EF D + V++ +G PNI DY P LR +DPQ + R T Y+K+ I DS I+ R + Sbjct: 203 EFSDLVVGVMEQIGKPNIADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLRS 262 Query: 192 SHSADK 209 S A K Sbjct: 263 SSVASK 268 >ref|XP_002301305.2| cytochrome P450 family protein [Populus trichocarpa] gi|550345061|gb|EEE80578.2| cytochrome P450 family protein [Populus trichocarpa] Length = 500 Score = 58.2 bits (139), Expect = 7e-06 Identities = 27/66 (40%), Positives = 38/66 (57%) Frame = +3 Query: 12 EFKDYLARVVDTVGSPNIVDYLPFLRALDPQRLLRDTEFYMKKCNGIIDSFIHNRVKFPH 191 EF + + V++ +G PNI DY P LR +DPQ + R T Y+K+ I DS I+ R + Sbjct: 207 EFSNLVVGVLEQIGKPNIADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLRS 266 Query: 192 SHSADK 209 S A K Sbjct: 267 SSVASK 272 >ref|XP_002301306.2| hypothetical protein POPTR_0002s15150g [Populus trichocarpa] gi|550345062|gb|EEE80579.2| hypothetical protein POPTR_0002s15150g [Populus trichocarpa] Length = 496 Score = 57.8 bits (138), Expect = 9e-06 Identities = 28/66 (42%), Positives = 37/66 (56%) Frame = +3 Query: 12 EFKDYLARVVDTVGSPNIVDYLPFLRALDPQRLLRDTEFYMKKCNGIIDSFIHNRVKFPH 191 EF D + V + +G PNI DY P LR +DPQ + R T Y+K+ I DS I+ R + Sbjct: 203 EFSDLVVGVTEQIGKPNIADYFPILRLVDPQGVRRKTNNYLKRLTQIFDSIINERTRPRS 262 Query: 192 SHSADK 209 S A K Sbjct: 263 SSVASK 268